Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CALCIUM-BINDING PEPTIDE, NMR, 30 STRUCTURES
 
Authors :  H. Sticht, A. Ejchart
Date :  09 Mar 98  (Deposition) - 16 Feb 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
Keywords :  Ef Hand Calcium Binding Loop, Alpha-Helix, Nmr Structure, Calcium-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Siedlecka, G. Goch, A. Ejchart, H. Sticht, A. Bierzyski
Alpha-Helix Nucleation By A Calcium-Binding Peptide Loop.
Proc. Natl. Acad. Sci. Usa V. 96 903 1999
PubMed-ID: 9927666  |  Reference-DOI: 10.1073/PNAS.96.3.903
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALCIUM-BINDING HEXADECAPEPTIDE
    Chains: A
    Engineered: YES
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: LA3+ ION BOUND
    Synonym: CALMODULIN

 Structural Features

(-) Chains, Units

  
NMR Structure (30x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

NMR Structure (3, 3)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2LA1Ligand/IonLANTHANUM (III) ION
3NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:1 , ASP A:3 , ASP A:5 , TYR A:7 , GLU A:12BINDING SITE FOR RESIDUE LA A 18

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NKF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NKF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

NMR Structure (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_073276D96VCALM2_HUMANDisease (LQT15)730882254AD3V
2UniProtVAR_073277N98ICALM2_HUMANDisease (LQT15)398124647AD5I
3UniProtVAR_078541N98SCALM1_HUMANDisease (CPVT4)398124647AD5S
4UniProtVAR_078543N98SCALM2_HUMANDisease (LQT15)398124647AD5S
5UniProtVAR_078261A103VCALM3_HUMANDisease  ---AA10V
6UniProtVAR_078542D130GCALM1_HUMANDisease (LQT14)730882252AQ16G
7UniProtVAR_078544D130GCALM2_HUMANDisease (LQT15)730882252AQ16G
8UniProtVAR_078262D130VCALM2_HUMANDisease (LQT15)  ---AQ16V
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.CALM_ORYLA1-36
37-72
74-109
110-136		  1-
-
-
A:15-15
CALM1_HUMAN8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM_ANAPL8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM_BOVIN8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM_CHICK8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CAM2B_XENLA8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM_RABIT8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM_TETCF8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CAM2A_XENLA8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM3_MOUSE8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM3_RAT8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALMA_ARBPU8-43
44-79
81-116
117-142		  1-
-
-
A:15-15
CALM_ONCSP8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM1_MOUSE8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM1_RAT8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM1_XENLA8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM2_HUMAN8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM2_MOUSE8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM2_RAT8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
CALM3_HUMAN8-43
44-79
81-116
117-149		  1-
-
-
A:15-15
2EF_HAND_1PS00018 EF-hand calcium-binding domain.CALM_ORYLA14-26
50-62
87-99
123-135		  1-
-
A:1-12
-
CALM1_HUMAN21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_ANAPL21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_BOVIN21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_CHICK21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CAM2B_XENLA21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_RABIT21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_TETCF21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CAM2A_XENLA21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM3_MOUSE21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM3_RAT21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALMA_ARBPU21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM_ONCSP21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM1_MOUSE21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM1_RAT21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM1_XENLA21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM2_HUMAN21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM2_MOUSE21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM2_RAT21-33
57-69
94-106
130-142		  1-
-
A:1-12
-
CALM3_HUMAN21-33
57-69
94-106
130-142		  1-
-
A:1-12
-

(-) Exons   (0, 0)

(no "Exon" information available for 1NKF)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM1_HUMAN | P0DP23 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM1_HUMAN    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) --------------------------------------- PROSITE (35)
               PROSITE (36) -EF_HAND_1    -----------------------EF PROSITE (36)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM1_MOUSE | P0DP26 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM1_MOUSE    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) -EF_HAND_1    -----------------------EF PROSITE (29)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM1_RAT | P0DP29 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
            CALM1_RAT    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) -EF_HAND_1    -----------------------EF PROSITE (27)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM1_XENLA | P0DP33 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM1_XENLA    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) -EF_HAND_1    -----------------------EF PROSITE (32)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM2_HUMAN | P0DP24 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM2_HUMAN    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) -EF_HAND_1    -----------------------EF PROSITE (30)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM2_MOUSE | P0DP27 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM2_MOUSE    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) --------------------------------------- PROSITE (35)
               PROSITE (36) --------------------------------------- PROSITE (36)
               PROSITE (37) --------------------------------------- PROSITE (37)
               PROSITE (38) --------------------------------------- PROSITE (38)
               PROSITE (39) --------------------------------------- PROSITE (39)
               PROSITE (40) -EF_HAND_1    -----------------------EF PROSITE (40)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM2_RAT | P0DP30 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
            CALM2_RAT    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) -EF_HAND_1    -----------------------EF PROSITE (35)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM3_HUMAN | P0DP25 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM3_HUMAN    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) -EF_HAND_1    -----------------------EF PROSITE (22)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM3_MOUSE | P0DP28 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CALM3_MOUSE    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) -EF_HAND_1    -----------------------EF PROSITE (31)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM3_RAT | P0DP31 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
            CALM3_RAT    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) -EF_HAND_1    -----------------------EF PROSITE (26)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALMA_ARBPU | P62146 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:39
                                   102       112       122         
          CALMA_ARBPU    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) --------------------------------------- PROSITE (35)
               PROSITE (36) --------------------------------------- PROSITE (36)
               PROSITE (37) -EF_HAND_1    -----------------------EF PROSITE (37)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_ANAPL | P62144 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_ANAPL    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) -EF_HAND_1    -----------------------EF PROSITE (24)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_BOVIN | P62157 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_BOVIN    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) --------------------------------------- PROSITE (35)
               PROSITE (36) --------------------------------------- PROSITE (36)
               PROSITE (37) --------------------------------------- PROSITE (37)
               PROSITE (38) -EF_HAND_1    -----------------------EF PROSITE (38)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_CHICK | P62149 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_CHICK    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) -EF_HAND_1    -----------------------EF PROSITE (23)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_ONCSP | P62156 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_ONCSP    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) -EF_HAND_1    -----------------------EF PROSITE (25)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_ORYLA | P62150 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:39
                                    95       105       115         
           CALM_ORYLA    86 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 124
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (1) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (1)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) -EF_HAND_1    -----------------------EF PROSITE (21)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_RABIT | P62160 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_RABIT    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) -EF_HAND_1    -----------------------EF PROSITE (33)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CALM_TETCF | P62151 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
           CALM_TETCF    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) -EF_HAND_1    -----------------------EF PROSITE (28)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CAM2A_XENLA | P0DP34 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CAM2A_XENLA    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) --------------------------------------- PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) --------------------------------------- PROSITE (34)
               PROSITE (35) --------------------------------------- PROSITE (35)
               PROSITE (36) --------------------------------------- PROSITE (36)
               PROSITE (37) --------------------------------------- PROSITE (37)
               PROSITE (38) --------------------------------------- PROSITE (38)
               PROSITE (39) -EF_HAND_1    -----------------------EF PROSITE (39)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2


Chain A from PDB  Type:PROTEIN  Length:18
 aligned with CAM2B_XENLA | P0DP35 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:39
                                   102       112       122         
          CAM2B_XENLA    93 FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
               SCOP domains --------------------------------------- SCOP domains
               CATH domains --------------------------------------- CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh---------------------h... Sec.struct. author
             SAPs(SNPs) (1) ---V-I----V--------------------------G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----S-------------------------------G- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----S-------------------------------V- SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------- PROSITE (17)
               PROSITE (18) EF_HAND_2  PDB: -       EF_HAND_2       PROSITE (18)
               PROSITE (19) --------------------------------------- PROSITE (19)
               PROSITE (20) --------------------------------------- PROSITE (20)
               PROSITE (21) --------------------------------------- PROSITE (21)
               PROSITE (22) --------------------------------------- PROSITE (22)
               PROSITE (23) --------------------------------------- PROSITE (23)
               PROSITE (24) --------------------------------------- PROSITE (24)
               PROSITE (25) --------------------------------------- PROSITE (25)
               PROSITE (26) --------------------------------------- PROSITE (26)
               PROSITE (27) --------------------------------------- PROSITE (27)
               PROSITE (28) --------------------------------------- PROSITE (28)
               PROSITE (29) --------------------------------------- PROSITE (29)
               PROSITE (30) --------------------------------------- PROSITE (30)
               PROSITE (31) --------------------------------------- PROSITE (31)
               PROSITE (32) --------------------------------------- PROSITE (32)
               PROSITE (33) --------------------------------------- PROSITE (33)
               PROSITE (34) -EF_HAND_1    -----------------------EF PROSITE (34)
                 Transcript --------------------------------------- Transcript
                 1nkf A   0 xDKDGDGYISAAEA---------------------AAQx  17
                            |        9   |     -         -     |  |
                            |           13                    14  |
                            0-ACE                                17-NH2
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1NKF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1NKF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1NKF)

(-) Gene Ontology  (86, 294)

NMR Structure(hide GO term definitions)
Chain A   (CALM1_RAT | P0DP29)

Chain A   (CALM3_MOUSE | P0DP28)

Chain A   (CALM1_HUMAN | P0DP23)

Chain A   (CALM_ANAPL | P62144)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

Chain A   (CALM_TETCF | P62151)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

Chain A   (CALM1_XENLA | P0DP33)

Chain A   (CALM2_HUMAN | P0DP24)

Chain A   (CALM1_MOUSE | P0DP26)

Chain A   (CAM2B_XENLA | P0DP35)

Chain A   (CALM_CHICK | P62149)
molecular function
    GO:0031997    N-terminal myristoylation domain binding    Interacting selectively and non-covalently with the N-terminus of a protein that has the potential to be, or has been, modified by N-terminal myristoylation. Binding affinity is typically altered by myristoylation; for example, N-terminal myristoylation of HIV Nef increases its affinity for calmodulin.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0017022    myosin binding    Interacting selectively and non-covalently with any part of a myosin complex; myosins are any of a superfamily of molecular motor proteins that bind to actin and use the energy of ATP hydrolysis to generate force and movement along actin filaments.
    GO:0043274    phospholipase binding    Interacting selectively and non-covalently with any phospholipase, enzymes that catalyze of the hydrolysis of a glycerophospholipid.
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0072542    protein phosphatase activator activity    Increases the activity of a protein phosphatase, an enzyme which catalyzes of the removal of a phosphate group from a protein substrate molecule.
    GO:0031996    thioesterase binding    Interacting selectively and non-covalently with any thioesterase enzyme.
    GO:0031432    titin binding    Interacting selectively and non-covalently with titin, any of a family of giant proteins found in striated and smooth muscle. In striated muscle, single titin molecules span half the sarcomere, with their N- and C-termini in the Z-disc and M-line, respectively.
biological process
    GO:0005513    detection of calcium ion    The series of events in which a calcium ion stimulus is received by a cell and converted into a molecular signal.
    GO:0030801    positive regulation of cyclic nucleotide metabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways involving cyclic nucleotides.
    GO:0051343    positive regulation of cyclic-nucleotide phosphodiesterase activity    Any process that activates or increases the frequency, rate or extent of cyclic nucleotide phosphodiesterase activity, the catalysis of the reaction: nucleotide 3',5'-cyclic phosphate + H2O = nucleotide 5'-phosphate.
    GO:0032516    positive regulation of phosphoprotein phosphatase activity    Any process that activates or increases the activity of a phosphoprotein phosphatase.
    GO:0035307    positive regulation of protein dephosphorylation    Any process that activates or increases the frequency, rate or extent of removal of phosphate groups from a protein.
    GO:0060316    positive regulation of ryanodine-sensitive calcium-release channel activity    Any process that increases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0055117    regulation of cardiac muscle contraction    Any process that modulates the frequency, rate or extent of cardiac muscle contraction.
    GO:0032465    regulation of cytokinesis    Any process that modulates the frequency, rate or extent of the division of the cytoplasm of a cell and its separation into two daughter cells.
    GO:0002027    regulation of heart rate    Any process that modulates the frequency or rate of heart contraction.
    GO:0010880    regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum    Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0021762    substantia nigra development    The progression of the substantia nigra over time from its initial formation until its mature state. The substantia nigra is the layer of gray substance that separates the posterior parts of the cerebral peduncles (tegmentum mesencephali) from the anterior parts; it normally includes a posterior compact part with many pigmented cells (pars compacta) and an anterior reticular part whose cells contain little pigment (pars reticularis).
cellular component
    GO:0034704    calcium channel complex    An ion channel complex through which calcium ions pass.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0030017    sarcomere    The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
    GO:0005876    spindle microtubule    Any microtubule that is part of a mitotic or meiotic spindle; anchored at one spindle pole.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.
    GO:0031982    vesicle    Any small, fluid-filled, spherical organelle enclosed by membrane.

Chain A   (CALM3_HUMAN | P0DP25)

Chain A   (CALM2_RAT | P0DP30)

Chain A   (CALM_BOVIN | P62157)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0006936    muscle contraction    A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
    GO:0060315    negative regulation of ryanodine-sensitive calcium-release channel activity    Any process that decreases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0043388    positive regulation of DNA binding    Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0060316    positive regulation of ryanodine-sensitive calcium-release channel activity    Any process that increases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0010880    regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum    Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
    GO:0022400    regulation of rhodopsin mediated signaling pathway    Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

Chain A   (CALM_RABIT | P62160)
molecular function
    GO:0031997    N-terminal myristoylation domain binding    Interacting selectively and non-covalently with the N-terminus of a protein that has the potential to be, or has been, modified by N-terminal myristoylation. Binding affinity is typically altered by myristoylation; for example, N-terminal myristoylation of HIV Nef increases its affinity for calmodulin.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0043274    phospholipase binding    Interacting selectively and non-covalently with any phospholipase, enzymes that catalyze of the hydrolysis of a glycerophospholipid.
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0072542    protein phosphatase activator activity    Increases the activity of a protein phosphatase, an enzyme which catalyzes of the removal of a phosphate group from a protein substrate molecule.
    GO:0031996    thioesterase binding    Interacting selectively and non-covalently with any thioesterase enzyme.
    GO:0031432    titin binding    Interacting selectively and non-covalently with titin, any of a family of giant proteins found in striated and smooth muscle. In striated muscle, single titin molecules span half the sarcomere, with their N- and C-termini in the Z-disc and M-line, respectively.
biological process
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0005513    detection of calcium ion    The series of events in which a calcium ion stimulus is received by a cell and converted into a molecular signal.
    GO:0043388    positive regulation of DNA binding    Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0030801    positive regulation of cyclic nucleotide metabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways involving cyclic nucleotides.
    GO:0051343    positive regulation of cyclic-nucleotide phosphodiesterase activity    Any process that activates or increases the frequency, rate or extent of cyclic nucleotide phosphodiesterase activity, the catalysis of the reaction: nucleotide 3',5'-cyclic phosphate + H2O = nucleotide 5'-phosphate.
    GO:0032516    positive regulation of phosphoprotein phosphatase activity    Any process that activates or increases the activity of a phosphoprotein phosphatase.
    GO:0035307    positive regulation of protein dephosphorylation    Any process that activates or increases the frequency, rate or extent of removal of phosphate groups from a protein.
    GO:0060316    positive regulation of ryanodine-sensitive calcium-release channel activity    Any process that increases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0055117    regulation of cardiac muscle contraction    Any process that modulates the frequency, rate or extent of cardiac muscle contraction.
    GO:0032465    regulation of cytokinesis    Any process that modulates the frequency, rate or extent of the division of the cytoplasm of a cell and its separation into two daughter cells.
    GO:0002027    regulation of heart rate    Any process that modulates the frequency or rate of heart contraction.
    GO:0010880    regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum    Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0021762    substantia nigra development    The progression of the substantia nigra over time from its initial formation until its mature state. The substantia nigra is the layer of gray substance that separates the posterior parts of the cerebral peduncles (tegmentum mesencephali) from the anterior parts; it normally includes a posterior compact part with many pigmented cells (pars compacta) and an anterior reticular part whose cells contain little pigment (pars reticularis).
cellular component
    GO:0034704    calcium channel complex    An ion channel complex through which calcium ions pass.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0030017    sarcomere    The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
    GO:0005876    spindle microtubule    Any microtubule that is part of a mitotic or meiotic spindle; anchored at one spindle pole.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.
    GO:0031982    vesicle    Any small, fluid-filled, spherical organelle enclosed by membrane.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

Chain A   (CALM_ORYLA | P62150)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

Chain A   (CALM_ONCSP | P62156)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

Chain A   (CAM2A_XENLA | P0DP34)

Chain A   (CALM2_MOUSE | P0DP27)

Chain A   (CALM3_RAT | P0DP31)

Chain A   (CALMA_ARBPU | P62146)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nkf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nkf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM1_MOUSE | P0DP26
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM1_RAT | P0DP29
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM1_XENLA | P0DP33
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_HUMAN | P0DP24
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_MOUSE | P0DP27
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_RAT | P0DP30
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_HUMAN | P0DP25
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_MOUSE | P0DP28
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_RAT | P0DP31
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALMA_ARBPU | P62146
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_ANAPL | P62144
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_BOVIN | P62157
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_CHICK | P62149
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_ONCSP | P62156
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_ORYLA | P62150
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_RABIT | P62160
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM_TETCF | P62151
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CAM2A_XENLA | P0DP34
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CAM2B_XENLA | P0DP35
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  614916
    Disease Information: OMIM
  616247
    Disease Information: OMIM
  616249
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM1_MOUSE | P0DP26
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM1_RAT | P0DP29
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM1_XENLA | P0DP33
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_HUMAN | P0DP24
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_MOUSE | P0DP27
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_RAT | P0DP30
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_HUMAN | P0DP25
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_MOUSE | P0DP28
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_RAT | P0DP31
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALMA_ARBPU | P62146
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_ANAPL | P62144
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_BOVIN | P62157
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_CHICK | P62149
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_ONCSP | P62156
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_ORYLA | P62150
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_RABIT | P62160
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM_TETCF | P62151
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CAM2A_XENLA | P0DP34
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CAM2B_XENLA | P0DP35
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CALM1_HUMAN | P0DP23: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1wrz 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2i08 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2l7l 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3evv 3ewt 3ewv 3g43 3hr4 3j41 3o77 3o78 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv
        CALM1_MOUSE | P0DP26: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 2dfs 2ix7 3cln 3wfn 4e50 4e53 4hex 4zlk
        CALM1_RAT | P0DP29: 1aji 1cm1 1cm4 1deg 1g4y 1k90 1k93 1lvc 1niw 1qiv 1qiw 1qx5 1qx7 1sk6 1up5 2hqw 2mgu 2pq3 2ygg 3b32 3bxk 3bxl 3cln 3ek4 3ek7 3ek8 3ekh 3ekj 3evr 3evu 3evv 3ifk 3sg2 3sg3 3sg4 3sg5 3sg6 3sg7 3sjq 3wlc 3wld 4ehq 4g27 4g28 4i2y 4il1 4j9y 4j9z 4oy4 4qnh 4rjd
        CALM1_XENLA | P0DP33: 1aji 1cfc 1cfd 1cff 1ckk 1cm1 1cm4 1deg 1dmo 1f70 1f71 1iq5 1k90 1k93 1lvc 1mux 1nwd 1qiv 1qiw 1sk6 1sy9 1up5 1x02 1y0v 2col 2i08 2k3s 2kdu 2llo 2llq 2mes 2rrt 3cln 4r8g 5t0x
        CALM2_HUMAN | P0DP24: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv
        CALM2_MOUSE | P0DP27: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 2dfs 2ix7 3cln 3wfn 4e50 4e53 4hex 4zlk
        CALM2_RAT | P0DP30: 1aji 1cm1 1cm4 1deg 1g4y 1k90 1k93 1lvc 1niw 1qiv 1qiw 1qx5 1qx7 1sk6 1up5 2hqw 2mgu 2pq3 2ygg 3b32 3bxk 3bxl 3cln 3evr 3evu 3ifk 3sjq 4ehq 4g27 4g28 4i2y 4il1 4j9y 4j9z 4oy4 4qnh 4rjd
        CALM3_HUMAN | P0DP25: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv
        CALM3_MOUSE | P0DP28: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 2dfs 2ix7 3cln 3wfn 4e50 4e53 4hex 4zlk
        CALM3_RAT | P0DP31: 1aji 1cm1 1cm4 1deg 1g4y 1k90 1k93 1lvc 1niw 1qiv 1qiw 1qx5 1qx7 1sk6 1up5 2hqw 2mgu 2pq3 2ygg 3b32 3bxk 3bxl 3cln 3evr 3evu 3ifk 3sjq 4ehq 4g27 4g28 4i2y 4il1 4j9y 4j9z 4oy4 4qnh 4rjd
        CALMA_ARBPU | P62146: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CALM_ANAPL | P62144: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CALM_BOVIN | P62157: 1a29 1aji 1ak8 1cdm 1cm1 1cm4 1cmf 1cmg 1deg 1fw4 1k90 1k93 1lin 1lvc 1prw 1qiv 1qiw 1sk6 1up5 1xa5 2cln 2f2o 2f2p 2fot 3cln 3if7
        CALM_CHICK | P62149: 1ahr 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 2bcx 2bki 2kz2 2m3s 2o5g 2o60 2vb6 3cln 3gof 3gp2 4bya 5hit
        CALM_ONCSP | P62156: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CALM_ORYLA | P62150: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CALM_RABIT | P62160: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CALM_TETCF | P62151: 1aji 1cm1 1cm4 1deg 1k90 1k93 1lvc 1qiv 1qiw 1sk6 1up5 3cln
        CAM2A_XENLA | P0DP34: 1aji 1cfc 1cfd 1cff 1ckk 1cm1 1cm4 1deg 1dmo 1f70 1f71 1iq5 1k90 1k93 1lvc 1mux 1nwd 1qiv 1qiw 1sk6 1sy9 1up5 1x02 1y0v 2col 2i08 2k3s 2kdu 2llo 2llq 2mes 2rrt 3cln 4r8g 5t0x
        CAM2B_XENLA | P0DP35: 1aji 1cfc 1cfd 1cff 1ckk 1cm1 1cm4 1deg 1dmo 1f70 1f71 1iq5 1k90 1k93 1lvc 1mux 1nwd 1qiv 1qiw 1sk6 1sy9 1up5 1x02 1y0v 2col 2i08 2k3s 2kdu 2llo 2llq 2mes 2rrt 3cln 4r8g 5t0x

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NKF)