Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NEGAMYCIN BINDS TO THE WALL OF THE NASCENT CHAIN EXIT TUNNEL OF THE 50S RIBOSOMAL SUBUNIT
 
Authors :  S. J. Schroeder, G. Blaha
Date :  26 Jun 07  (Deposition) - 30 Sep 08  (Release) - 27 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,9
Keywords :  Large Ribosomal Subunit, 50S, Negamycin, Haloarcula Marismortui, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. J. Schroeder, G. Blaha, P. B. Moore
Negamycin Binds To The Wall Of The Nascent Chain Exit Tunne Of The 50S Ribosomal Subunit.
Antimicrob. Agents Chemother. V. 51 4462 2007
PubMed-ID: 17664317  |  Reference-DOI: 10.1128/AAC.00455-07

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L4P
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 9 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ01239

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (11, 237)

Asymmetric/Biological Unit (11, 237)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2CD5Ligand/IonCADMIUM ION
3CL22Ligand/IonCHLORIDE ION
4K2Ligand/IonPOTASSIUM ION
5MG116Ligand/IonMAGNESIUM ION
6NA86Ligand/IonSODIUM ION
7NEG1Ligand/IonNEGAMYCIN
8OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
9OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
10PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
11UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (231, 231)

Asymmetric Unit (231, 231)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:3441 , HOH 0:7610 , HOH 0:8997BINDING SITE FOR RESIDUE MG 0 8001
002AC2SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , HOH 0:4176 , HOH 0:7588 , HOH 0:7589BINDING SITE FOR RESIDUE MG 0 8002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:3489 , HOH 0:8843 , HOH 0:9658BINDING SITE FOR RESIDUE MG 0 8003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:3611 , HOH 0:7595 , HOH 0:8870 , HOH 0:9609BINDING SITE FOR RESIDUE MG 0 8004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:3437 , HOH 0:7611 , HOH 0:7612BINDING SITE FOR RESIDUE MG 0 8005
006AC6SOFTWAREU 0:821 , C 0:822 , G 0:854 , HOH 0:3443 , HOH 0:3580 , HOH 0:9639BINDING SITE FOR RESIDUE MG 0 8006
007AC7SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:3183 , HOH 0:7600 , HOH 0:8829BINDING SITE FOR RESIDUE MG 0 8007
008AC8SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:3454 , HOH 0:7604 , HOH 0:7689BINDING SITE FOR RESIDUE MG 0 8008
009AC9SOFTWAREG 0:2093 , G 0:2611 , A 0:2612 , HOH 0:3565 , HOH 0:7276 , HOH 0:7605 , HOH 0:7606 , NA 0:8558BINDING SITE FOR RESIDUE MG 0 8009
010BC1SOFTWAREG 0:836 , U 0:2615 , HOH 0:3667 , HOH 0:9185 , GLN B:230 , HOH B:8827BINDING SITE FOR RESIDUE MG 0 8010
011BC2SOFTWAREG 0:824 , G 0:854 , HOH 0:3793 , HOH 0:4141 , HOH 0:4275 , HOH 0:4383BINDING SITE FOR RESIDUE MG 0 8011
012BC3SOFTWAREG 0:28 , HOH 0:3059 , HOH 0:3472 , HOH 0:7690 , HOH 0:8862 , HOH 0:9461BINDING SITE FOR RESIDUE MG 0 8012
013BC4SOFTWAREG 0:877 , G 0:2623 , HOH 0:3466 , HOH 0:3479 , HOH 0:7619 , HOH 0:8842BINDING SITE FOR RESIDUE MG 0 8013
014BC5SOFTWAREG 0:2102 , G 0:2537 , HOH 0:3482 , HOH 0:4008 , HOH 0:7586 , HOH 0:8856BINDING SITE FOR RESIDUE MG 0 8014
015BC6SOFTWAREA 0:844 , A 0:1689 , HOH 0:3447 , HOH 0:7621 , HOH 0:8827 , HOH 0:8846BINDING SITE FOR RESIDUE MG 0 8015
016BC7SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:3572 , HOH 0:7613 , HOH 0:7614BINDING SITE FOR RESIDUE MG 0 8016
017BC8SOFTWAREG 0:456 , HOH 0:3778 , HOH 0:7596 , HOH 0:9238 , HOH C:8555 , HOH C:8659BINDING SITE FOR RESIDUE MG 0 8017
018BC9SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3052 , HOH 0:3439 , HOH 0:7310 , HOH 0:7691BINDING SITE FOR RESIDUE MG 0 8018
019CC1SOFTWAREA 0:2011 , HOH 0:3995 , HOH 0:7083 , HOH 0:7615 , HOH 0:7616 , HOH 0:7617BINDING SITE FOR RESIDUE MG 0 8019
020CC2SOFTWAREG 0:1828 , C 0:1830 , HOH 0:7599 , HOH 0:7618 , HOH 0:8942 , HOH 0:8945 , HOH 0:9019BINDING SITE FOR RESIDUE MG 0 8020
021CC3SOFTWAREG 0:2304 , HOH 0:3462 , HOH 0:3463 , HOH 0:7602 , HOH 0:7603 , HOH 0:9795BINDING SITE FOR RESIDUE MG 0 8021
022CC4SOFTWAREG 0:2097 , G 0:2540 , HOH 0:3700 , HOH 0:7607 , HOH 0:8931 , HOH 0:9280BINDING SITE FOR RESIDUE MG 0 8022
023CC5SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3452 , HOH 0:3649 , HOH 0:7623BINDING SITE FOR RESIDUE MG 0 8023
024CC6SOFTWAREA 0:1381 , HOH 0:9767BINDING SITE FOR RESIDUE MG 0 8024
025CC7SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4014 , HOH 0:7624 , HOH 0:7625 , HOH 0:7694BINDING SITE FOR RESIDUE MG 0 8025
026CC8SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:7626 , HOH 0:7627 , HOH 0:9217BINDING SITE FOR RESIDUE MG 0 8026
027CC9SOFTWAREC 0:240 , G 0:269 , HOH 0:3703 , HOH 0:3855 , HOH 0:4000 , HOH 0:7695BINDING SITE FOR RESIDUE MG 0 8027
028DC1SOFTWAREA 0:1448 , U 0:1677 , HOH 0:3501 , HOH 0:3523 , HOH 0:3535 , HOH S:8551BINDING SITE FOR RESIDUE MG 0 8028
029DC2SOFTWAREA 0:1502 , U 0:1503 , C 0:1679 , HOH 0:7630 , HOH 0:7631 , HOH 0:7632 , HOH 0:7633BINDING SITE FOR RESIDUE MG 0 8029
030DC3SOFTWAREU 0:1748 , U 0:1749 , HOH 0:3464 , HOH 0:7597 , HOH 0:7598 , HOH 0:7608BINDING SITE FOR RESIDUE MG 0 8030
031DC4SOFTWAREU 0:777 , C 0:778 , HOH 0:3105 , HOH 0:7635 , HOH 0:7636 , HOH 0:7637 , NA 0:8525BINDING SITE FOR RESIDUE MG 0 8031
032DC5SOFTWAREU 0:2115 , HOH 0:3550 , HOH 0:3617 , HOH 0:4036 , HOH 0:9821 , HOH A:8921BINDING SITE FOR RESIDUE MG 0 8032
033DC6SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3644 , HOH 0:9501BINDING SITE FOR RESIDUE MG 0 8033
034DC7SOFTWAREA 0:2302 , A 0:2303 , HOH 0:3467 , HOH 0:3598 , HOH 0:4723 , HOH 0:7638BINDING SITE FOR RESIDUE MG 0 8034
035DC8SOFTWAREG 0:1484 , HOH 0:3540 , HOH 0:7639 , HOH 0:7640 , HOH 0:7697 , HOH 0:7698BINDING SITE FOR RESIDUE MG 0 8035
036DC9SOFTWAREG 0:956 , HOH 0:3493 , HOH 0:7641 , HOH 0:7642 , HOH 0:7643 , HOH 0:9191BINDING SITE FOR RESIDUE MG 0 8036
037EC1SOFTWAREA 0:2553 , HOH 0:3042 , HOH 0:3473 , HOH 0:7699 , HOH 0:8898 , HOH 0:9966BINDING SITE FOR RESIDUE MG 0 8037
038EC2SOFTWAREHOH 0:3450 , HOH 0:3474 , HOH 0:3494 , HOH 0:3496 , HOH 0:7645 , HOH 0:9106BINDING SITE FOR RESIDUE MG 0 8038
039EC3SOFTWAREU 0:115 , G 0:118 , HOH 0:3801 , HOH 0:4956 , HOH 0:9742BINDING SITE FOR RESIDUE MG 0 8039
040EC4SOFTWAREU 0:392 , HOH 0:3618 , HOH 0:4499 , HOH 0:7701 , HOH 0:7702 , HOH 0:9518BINDING SITE FOR RESIDUE MG 0 8040
041EC5SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:3949 , HOH 0:4047 , HOH 0:5233BINDING SITE FOR RESIDUE MG 0 8041
042EC6SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3481 , HOH 0:4271 , HOH 0:7648 , HOH 0:9260BINDING SITE FOR RESIDUE MG 0 8042
043EC7SOFTWAREG 0:816 , G 0:817 , HOH 0:7264 , MG 0:8106BINDING SITE FOR RESIDUE MG 0 8043
044EC8SOFTWAREC 0:2048 , A 0:2089 , HOH 0:3124 , HOH 0:7649 , GLY R:65BINDING SITE FOR RESIDUE MG 0 8044
045EC9SOFTWAREG 0:1979 , HOH 0:7650 , HOH 0:7704BINDING SITE FOR RESIDUE MG 0 8045
046FC1SOFTWAREG 0:1794 , HOH 0:7143 , HOH 0:7706 , HOH 0:7707BINDING SITE FOR RESIDUE MG 0 8046
047FC2SOFTWAREA 0:1098 , HOH 0:6123 , HOH 0:7721 , HOH 0:9960BINDING SITE FOR RESIDUE MG 0 8047
048FC3SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:5732 , HOH 0:6114 , HOH 0:7739BINDING SITE FOR RESIDUE MG 0 8048
049FC4SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:7709 , HOH 0:7710BINDING SITE FOR RESIDUE MG 0 8049
050FC5SOFTWAREC 0:2248 , HOH 0:7168BINDING SITE FOR RESIDUE MG 0 8050
051FC6SOFTWAREG 0:641 , A 0:1355 , HOH 0:3945 , HOH 0:7651 , HOH 0:7652BINDING SITE FOR RESIDUE MG 0 8051
052FC7SOFTWAREU 0:1125 , C 0:1129 , HOH 0:3686 , HOH 9:737 , HOH 9:2054 , G 9:3092 , HOH 9:7866BINDING SITE FOR RESIDUE MG 0 8052
053FC8SOFTWAREG 0:471 , HOH 0:4251 , HOH 0:5469 , HOH 0:9027 , HOH 0:9066 , HOH 0:9873BINDING SITE FOR RESIDUE MG 0 8053
054FC9SOFTWAREC 0:162 , U 0:2276 , HOH 0:7601 , HOH 0:7653 , HOH 0:7654 , HOH 0:9256BINDING SITE FOR RESIDUE MG 0 8054
055GC1SOFTWAREHOH 0:3584 , HOH 0:6267 , HOH 0:7552 , HOH B:8853 , HOH B:8954 , HOH B:8955BINDING SITE FOR RESIDUE MG B 8055
056GC2SOFTWAREA 0:2757 , HOH 0:3491 , HOH 0:3811 , HOH 0:7673 , ASN B:335 , HOH B:8843BINDING SITE FOR RESIDUE MG 0 8056
057GC3SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:4867 , MG 0:8058 , GLN A:207BINDING SITE FOR RESIDUE MG 0 8057
058GC4SOFTWAREU 0:1883 , G 0:2013 , HOH 0:3592 , HOH 0:7655 , HOH 0:7656 , HOH 0:7657 , HOH 0:7723 , MG 0:8057BINDING SITE FOR RESIDUE MG 0 8058
059GC5SOFTWAREG 0:2618 , HOH 0:3546 , HOH 0:3892 , HOH 0:7609 , HOH 0:8861 , HOH 0:8865BINDING SITE FOR RESIDUE MG 0 8059
060GC6SOFTWAREG 0:175 , HOH 0:7658 , HOH 0:7659 , HOH 0:7660 , HOH 0:8990BINDING SITE FOR RESIDUE MG 0 8060
061GC7SOFTWAREA 0:1369 , U 0:2650 , HOH 0:7661 , HOH 0:7662 , HOH 0:7663 , HOH 0:9650BINDING SITE FOR RESIDUE MG 0 8061
062GC8SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3457 , HOH 0:3792 , HOH 0:6028 , HOH 0:9220BINDING SITE FOR RESIDUE MG 0 8062
063GC9SOFTWAREHOH 0:4026 , HOH 0:6856 , HOH 0:7594 , HOH 0:7672BINDING SITE FOR RESIDUE MG 0 8063
064HC1SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3588 , HOH 0:9414BINDING SITE FOR RESIDUE MG 0 8064
065HC2SOFTWAREC 0:783 , HOH 0:3806 , HOH A:8820 , HOH A:8832 , HOH A:8847 , HOH A:8895 , HOH A:8922BINDING SITE FOR RESIDUE MG A 8065
066HC3SOFTWAREHOH 0:5789 , HOH 0:7734 , ASP A:26 , GLU A:28 , HOH A:8846 , HOH A:8857BINDING SITE FOR RESIDUE MG A 8066
067HC4SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:7665 , ASN A:188BINDING SITE FOR RESIDUE MG 0 8067
068HC5SOFTWAREA 0:2568 , HOH 0:3578 , HOH 0:4678 , HOH 0:7725 , HOH 0:9563 , HOH E:5607BINDING SITE FOR RESIDUE MG 0 8068
069HC6SOFTWAREHOH 0:4088 , HOH 0:5896 , ASN K:42 , HOH K:1797 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8069
070HC7SOFTWAREA 0:166 , G 0:219 , HOH 0:3645 , HOH 0:4814 , HOH 0:5445 , HOH 0:8943BINDING SITE FOR RESIDUE MG 0 8070
071HC8SOFTWAREHOH 0:3954 , HOH 0:5904 , HOH 0:7269 , HOH 0:7399 , HOH 0:7670 , HOH 0:7671BINDING SITE FOR RESIDUE MG 0 8071
072HC9SOFTWAREG 0:953 , U 0:954 , HOH 0:3063 , HOH 0:3835 , HOH 0:7669 , HOH 0:7726BINDING SITE FOR RESIDUE MG 0 8072
073IC1SOFTWAREGLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8073
074IC2SOFTWAREA 0:1286 , A 0:1287 , HOH 0:7666 , HOH 0:7667 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8074
075IC3SOFTWAREA 0:907 , A 0:908 , HOH 0:3461 , HOH 0:3749 , HOH 0:4792 , HOH 0:7668BINDING SITE FOR RESIDUE MG 0 8075
076IC4SOFTWAREHOH 0:6706 , HOH 0:7675 , HOH 0:7728 , HOH 2:7875BINDING SITE FOR RESIDUE MG 0 8076
077IC5SOFTWAREC 0:880 , U 0:883 , HOH 0:3448 , HOH 0:7676 , HOH 0:7677 , HOH 0:9065BINDING SITE FOR RESIDUE MG 0 8077
078IC6SOFTWAREGLY 3:45 , GLY 3:47 , ASP 3:49 , HOH 3:8827 , HOH 3:8878 , HOH 3:8879BINDING SITE FOR RESIDUE MG 3 8078
079IC7SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:3436 , HOH 0:3442 , HOH 0:3453 , NA 0:8515BINDING SITE FOR RESIDUE MG 0 8079
080IC8SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4052 , HOH 0:4347 , HOH 0:7678BINDING SITE FOR RESIDUE MG 0 8080
081IC9SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:3940BINDING SITE FOR RESIDUE MG 0 8081
082JC1SOFTWAREC 0:1436 , A 0:1437 , HOH 0:5013 , HOH 0:5099 , HOH 0:7735 , HOH P:7890BINDING SITE FOR RESIDUE MG 0 8082
083JC2SOFTWAREA 0:1754 , HOH 0:3531 , HOH 0:3996 , HOH 0:7679BINDING SITE FOR RESIDUE MG 0 8083
084JC3SOFTWAREA 0:1742 , HOH 0:3459 , HOH 0:7680 , HOH 0:9074 , HOH 0:9198 , HOH 0:9582BINDING SITE FOR RESIDUE MG 0 8084
085JC4SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3616 , HOH 0:4210 , HOH 0:4339 , HOH 0:8861 , HOH 0:9426BINDING SITE FOR RESIDUE MG 0 8085
086JC5SOFTWAREA 0:532 , U 0:533 , HOH 0:3559 , HOH 0:3812 , HOH 0:7682BINDING SITE FOR RESIDUE MG 0 8086
087JC6SOFTWAREA 0:682 , G 0:683 , HOH 0:3500 , HOH 0:7736BINDING SITE FOR RESIDUE MG 0 8087
088JC7SOFTWAREG 0:2540 , G 0:2611 , HOH 0:4143 , NA 0:8539 , HOH 0:8885 , HOH 0:9119 , HOH 0:9878BINDING SITE FOR RESIDUE MG 0 8088
089JC8SOFTWAREU 0:517 , G 0:518 , NEG 0:8823BINDING SITE FOR RESIDUE MG 0 8089
090JC9SOFTWAREA 0:2103 , U 0:2478 , HOH 0:3440BINDING SITE FOR RESIDUE MG 0 8090
091KC1SOFTWAREG 0:918 , HOH 0:3151 , HOH 0:6336 , HOH 0:7684 , HOH 0:8913 , HOH 0:9372BINDING SITE FOR RESIDUE MG 0 8091
092KC2SOFTWAREA 0:1843 , C 0:1844 , HOH 0:3469 , HOH 0:3483 , HOH 0:9210BINDING SITE FOR RESIDUE MG 0 8092
093KC3SOFTWAREG 0:627 , A 0:1070 , G 0:1071 , HOH 0:3475 , HOH 0:3505 , HOH 0:3547 , HOH 0:9508BINDING SITE FOR RESIDUE MG 0 8093
094KC4SOFTWAREU 0:1096 , C 0:1257 , HOH 0:7685 , HOH 0:7731BINDING SITE FOR RESIDUE MG 0 8094
095KC5SOFTWAREG 9:3021 , A 9:3056 , A 9:3057 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8095
096KC6SOFTWAREG 0:1848 , G 0:1849 , HOH 0:3486 , HOH 0:3524 , HOH 0:3663 , HOH 0:3695BINDING SITE FOR RESIDUE MG 0 8096
097KC7SOFTWAREG 0:863 , U 0:864 , HOH 0:3165 , HOH 0:3495 , HOH 0:3499 , HOH 0:5408BINDING SITE FOR RESIDUE MG 0 8097
098KC8SOFTWAREA 0:907 , HOH 0:3195 , HOH 0:3507 , HOH 0:3574 , HOH 0:9774BINDING SITE FOR RESIDUE MG 0 8098
099KC9SOFTWAREA 0:2612 , HOH 0:3490 , HOH 0:3502 , HOH 0:9846BINDING SITE FOR RESIDUE MG 0 8099
100LC1SOFTWAREHOH 0:3595 , HOH 0:4098 , HOH 0:5360 , HOH 0:6008 , HOH 0:6448BINDING SITE FOR RESIDUE MG 0 8100
101LC2SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:3573 , HOH 0:4478 , HOH 0:6761BINDING SITE FOR RESIDUE MG 0 8101
102LC3SOFTWAREA 0:2434 , U 0:2458 , HOH 0:7740 , HOH 0:9077 , HOH 0:9723 , HOH 3:8824BINDING SITE FOR RESIDUE MG 0 8102
103LC4SOFTWAREG 0:2578 , G 0:2579 , HOH 0:7732BINDING SITE FOR RESIDUE MG 0 8103
104LC5SOFTWAREC 0:2104 , C 0:2105 , HOH 0:7590 , HOH 0:7591 , HOH 0:7592BINDING SITE FOR RESIDUE MG 0 8104
105LC6SOFTWAREG 0:817 , HOH 0:3425 , HOH 0:7259 , MG 0:8043 , SER P:90 , HOH P:5319BINDING SITE FOR RESIDUE MG 0 8106
106LC7SOFTWAREA 0:1106 , A 0:1107 , HOH 0:7711 , HOH 0:7712 , HOH 0:7713 , HOH 0:7714BINDING SITE FOR RESIDUE MG 0 8107
107LC8SOFTWAREG 0:2001 , HOH 0:7338 , HOH 0:7716 , HOH 0:7717 , HOH 0:7718BINDING SITE FOR RESIDUE MG 0 8108
108LC9SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:8143 , HOH Y:8161 , HOH Y:8196BINDING SITE FOR RESIDUE MG Y 8109
109MC1SOFTWAREU 0:903 , A 0:1357 , HOH 0:3759 , HOH 0:5257 , HOH 0:5885 , HOH 0:9334BINDING SITE FOR RESIDUE MG 0 8110
110MC2SOFTWAREG 0:2609 , U 0:2610 , HOH 0:3128 , HOH 0:3521 , HOH 0:3545 , HOH 0:5455 , HOH 0:5605BINDING SITE FOR RESIDUE MG 0 8111
111MC3SOFTWAREA 0:187 , HOH 0:3552 , HOH 0:3596 , HOH 0:8949 , HOH 0:9154 , HOH 0:9393BINDING SITE FOR RESIDUE MG 0 8112
112MC4SOFTWAREA 0:2112 , HOH 0:3579 , HOH 0:3757 , HOH 0:5983 , HOH 0:6248 , HOH 0:9414BINDING SITE FOR RESIDUE MG 0 8113
113MC5SOFTWAREA 0:2430 , HOH 0:3492 , HOH 0:3800 , HOH 0:9173 , HOH 0:9274BINDING SITE FOR RESIDUE MG 0 8114
114MC6SOFTWAREHOH 0:3747 , HOH 0:4136 , HOH 0:4153 , HOH 0:6456 , HOH 0:6587 , MG 0:8116BINDING SITE FOR RESIDUE MG 0 8115
115MC7SOFTWAREU 0:1850 , HOH 0:3486 , HOH 0:3512 , HOH 0:3695 , HOH 0:3747 , HOH 0:6587 , MG 0:8115BINDING SITE FOR RESIDUE MG 0 8116
116MC8SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:4492 , HOH 0:6413 , HOH 0:9048BINDING SITE FOR RESIDUE MG 0 8117
117MC9SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 8401
118NC1SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:8837 , HOH 0:8965 , ARG M:82BINDING SITE FOR RESIDUE K 0 8402
119NC2SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:4826 , HOH 0:9998BINDING SITE FOR RESIDUE NA 0 8501
120NC3SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:7625BINDING SITE FOR RESIDUE NA 0 8502
121NC4SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:6435 , HOH 0:7414 , HOH 0:9254BINDING SITE FOR RESIDUE NA 0 8503
122NC5SOFTWAREASP C:45 , THR C:94 , LYS C:96BINDING SITE FOR RESIDUE NA C 8504
123NC6SOFTWAREA 0:630 , A 0:631 , A 0:632 , HOH 0:3932 , HOH 0:4559 , HOH 0:5640BINDING SITE FOR RESIDUE NA 0 8505
124NC7SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649BINDING SITE FOR RESIDUE NA 0 8506
125NC8SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 8507
126NC9SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:3237BINDING SITE FOR RESIDUE NA 0 8508
127OC1SOFTWAREA 0:1133 , G 0:1134 , TYR H:154 , ILE H:157 , THR H:158 , PRO H:159BINDING SITE FOR RESIDUE NA 0 8509
128OC2SOFTWAREA 0:2577 , G 0:2578 , G 0:2579BINDING SITE FOR RESIDUE NA 0 8510
129OC3SOFTWAREG 0:2524 , G 0:2525 , HOH 0:3401 , HOH 0:4510 , HOH 0:9005BINDING SITE FOR RESIDUE NA 0 8511
130OC4SOFTWAREHIS S:7 , GLU S:61BINDING SITE FOR RESIDUE NA S 8512
131OC5SOFTWAREG 0:2399 , HOH 0:3664 , HOH 0:4925 , HOH 0:4974 , HOH 0:5910 , HOH 0:9784BINDING SITE FOR RESIDUE NA 0 8513
132OC6SOFTWAREU 0:2541 , U 0:2607 , C 0:2608 , HOH 0:9155 , HOH 0:9961 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8514
133OC7SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:3436 , MG 0:8079BINDING SITE FOR RESIDUE NA 0 8515
134OC8SOFTWAREC 0:896 , A 0:897 , HOH 0:6165 , HOH 0:7526BINDING SITE FOR RESIDUE NA 0 8516
135OC9SOFTWAREG 0:1416 , G 0:1417 , HOH 0:9101 , TRP 2:42 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 0 8517
136PC1SOFTWAREG 0:2543 , G 0:2544 , HOH 0:3763 , NA 0:8520 , HOH 0:9035BINDING SITE FOR RESIDUE NA 0 8518
137PC2SOFTWAREA 0:2465 , G 0:2466 , HOH 0:4109 , HOH 0:5898 , ASP L:36 , HOH L:8837BINDING SITE FOR RESIDUE NA 0 8519
138PC3SOFTWAREG 0:2543 , G 0:2611 , U 0:2615 , NA 0:8518 , HOH 0:8879 , HOH 0:8908 , HOH 0:9573BINDING SITE FOR RESIDUE NA 0 8520
139PC4SOFTWAREG 0:836 , U 0:837 , A 0:1736 , ARG B:229BINDING SITE FOR RESIDUE NA 0 8521
140PC5SOFTWAREC 0:2287 , ASP H:111 , ARG H:114BINDING SITE FOR RESIDUE NA H 8522
141PC6SOFTWAREG 0:885 , A 0:2112 , C 0:2475 , C 0:2476 , HOH 0:4333BINDING SITE FOR RESIDUE NA 0 8523
142PC7SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:9318BINDING SITE FOR RESIDUE NA 0 8524
143PC8SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3105 , HOH 0:7502 , MG 0:8031 , HOH 0:9450BINDING SITE FOR RESIDUE NA 0 8525
144PC9SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 0 8526
145QC1SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:8860 , HOH 0:9559BINDING SITE FOR RESIDUE NA 0 8527
146QC2SOFTWAREG 0:56 , A 0:59 , G 0:61 , C 0:62 , HOH 0:5069 , HOH 0:6331BINDING SITE FOR RESIDUE NA 0 8528
147QC3SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:6431BINDING SITE FOR RESIDUE NA 0 8529
148QC4SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9058BINDING SITE FOR RESIDUE NA 0 8530
149QC5SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:9124BINDING SITE FOR RESIDUE NA 0 8531
150QC6SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402BINDING SITE FOR RESIDUE NA 0 8532
151QC7SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE NA 0 8533
152QC8SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5104BINDING SITE FOR RESIDUE NA 0 8534
153QC9SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , A 0:632 , HOH 0:9705BINDING SITE FOR RESIDUE NA 0 8535
154RC1SOFTWAREG 0:1706 , G 0:1707 , HOH 0:5194 , HOH 0:7529 , HOH 0:9755BINDING SITE FOR RESIDUE NA 0 8536
155RC2SOFTWAREHOH 0:3586 , SER R:70 , VAL R:72 , ASP R:73 , HOH R:8825 , HOH R:8860BINDING SITE FOR RESIDUE NA R 8537
156RC3SOFTWAREU 0:2659 , G 0:2660 , HOH 0:3586 , VAL R:72 , GLY R:74 , TRP R:75 , HOH R:8815BINDING SITE FOR RESIDUE NA R 8538
157RC4SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , MG 0:8088BINDING SITE FOR RESIDUE NA 0 8539
158RC5SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:6128BINDING SITE FOR RESIDUE NA 0 8540
159RC6SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:3860BINDING SITE FOR RESIDUE NA 0 8541
160RC7SOFTWAREC 0:893 , HOH 0:3131 , HOH 0:5480BINDING SITE FOR RESIDUE NA 0 8542
161RC8SOFTWAREU 0:308 , U 0:335 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 0 8543
162RC9SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:9047BINDING SITE FOR RESIDUE NA 0 8544
163SC1SOFTWAREA 0:2633 , PHE A:201 , GLY A:203 , HIS A:208 , HOH A:8852 , HOH A:8894BINDING SITE FOR RESIDUE NA A 8545
164SC2SOFTWAREHOH 0:5614 , HOH 0:9308 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69BINDING SITE FOR RESIDUE NA J 8546
165SC3SOFTWARESER M:106 , PHE M:109 , LEU M:112 , HOH M:8921BINDING SITE FOR RESIDUE NA M 8547
166SC4SOFTWAREASP Q:20 , ARG Q:21 , GLY Q:22 , THR Q:23 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427BINDING SITE FOR RESIDUE NA Q 8548
167SC5SOFTWAREA 0:914 , C 0:915 , C 0:1043 , G 0:1045 , HOH 0:5442BINDING SITE FOR RESIDUE NA 0 8549
168SC6SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:6811 , HOH 0:7587BINDING SITE FOR RESIDUE NA 0 8550
169SC7SOFTWAREA 0:955 , C 9:3081 , U 9:3082BINDING SITE FOR RESIDUE NA 9 8552
170SC8SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:4732 , HOH 0:9037 , GLY L:14BINDING SITE FOR RESIDUE NA 0 8553
171SC9SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:4675BINDING SITE FOR RESIDUE NA 0 8554
172TC1SOFTWAREG 0:1119 , C 0:1243 , HOH 0:4667 , ILE J:46 , THR J:47BINDING SITE FOR RESIDUE NA 0 8555
173TC2SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:9277BINDING SITE FOR RESIDUE NA 0 8556
174TC3SOFTWAREG 0:941 , U 0:942 , HOH 0:6127BINDING SITE FOR RESIDUE NA 0 8557
175TC4SOFTWAREG 0:2094 , G 0:2611 , HOH 0:3565 , HOH 0:7276 , HOH 0:7622 , MG 0:8009BINDING SITE FOR RESIDUE NA 0 8558
176TC5SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 8559
177TC6SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5811BINDING SITE FOR RESIDUE NA 0 8560
178TC7SOFTWAREU 0:837 , HOH 0:4760 , HOH 0:7184 , GLN B:230BINDING SITE FOR RESIDUE NA 0 8561
179TC8SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277 , HOH 0:5163BINDING SITE FOR RESIDUE NA 0 8562
180TC9SOFTWAREC 0:1360 , HOH 0:3302 , HOH 0:6897BINDING SITE FOR RESIDUE NA 0 8563
181UC1SOFTWAREU 0:2057 , G 0:2058 , HOH 0:9647BINDING SITE FOR RESIDUE NA 0 8564
182UC2SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , ALA M:194BINDING SITE FOR RESIDUE NA 0 8565
183UC3SOFTWAREG 0:544 , G 0:545 , U 0:611 , HOH 0:3711 , HOH 0:9699 , HOH 0:9716BINDING SITE FOR RESIDUE NA 0 8566
184UC4SOFTWAREG 0:464 , G 0:475 , HOH 0:4460 , HOH 0:9661 , ARG C:55BINDING SITE FOR RESIDUE NA 0 8567
185UC5SOFTWAREG 0:798 , G 0:814 , U 0:815 , G 0:816BINDING SITE FOR RESIDUE NA 0 8568
186UC6SOFTWAREU 0:391 , U 0:392 , A 0:395 , U 0:398 , HOH 0:6426BINDING SITE FOR RESIDUE NA 0 8569
187UC7SOFTWAREG 0:1832 , HOH 0:3944 , HOH 0:8925BINDING SITE FOR RESIDUE NA 0 8570
188UC8SOFTWAREG 0:2491 , U 0:2492 , G 0:2529 , HOH 0:9451BINDING SITE FOR RESIDUE NA 0 8571
189UC9SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924BINDING SITE FOR RESIDUE NA 0 8572
190VC1SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:3503BINDING SITE FOR RESIDUE NA 0 8573
191VC2SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 0 8574
192VC3SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9088BINDING SITE FOR RESIDUE NA 0 8575
193VC4SOFTWAREA 0:632 , C 0:633 , A 0:2538 , U 0:2539 , HOH 0:3471 , HOH 0:4713BINDING SITE FOR RESIDUE NA 0 8576
194VC5SOFTWAREU 0:1293 , HOH 0:6192BINDING SITE FOR RESIDUE NA 0 8577
195VC6SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3040 , HIS L:18 , HOH L:8833 , HOH L:8851BINDING SITE FOR RESIDUE NA 0 8578
196VC7SOFTWAREU 0:832 , G 0:833 , HOH 0:3538 , HOH 0:4279BINDING SITE FOR RESIDUE NA 0 8579
197VC8SOFTWAREARG L:27 , GLU L:39 , HOH L:8818 , HOH L:8831 , HOH L:8893BINDING SITE FOR RESIDUE NA L 8580
198VC9SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:3514 , HOH 0:6925 , HOH 0:9153BINDING SITE FOR RESIDUE NA 0 8581
199WC1SOFTWAREG 0:2772 , G 0:2773 , A 0:2801 , HOH 0:4223BINDING SITE FOR RESIDUE NA 0 8582
200WC2SOFTWAREG 9:3058 , C 9:3059BINDING SITE FOR RESIDUE NA 9 8583
201WC3SOFTWAREC 0:197 , HOH 0:4874 , HOH 0:5107BINDING SITE FOR RESIDUE NA 0 8584
202WC4SOFTWAREG 0:1077 , A 0:1079 , HOH 0:7522BINDING SITE FOR RESIDUE NA 0 8585
203WC5SOFTWAREGLN R:61 , ASN R:63BINDING SITE FOR RESIDUE NA R 8586
204WC6SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 8701
205WC7SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 8702
206WC8SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 8703
207WC9SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74 , HOH 3:8863BINDING SITE FOR RESIDUE CD 3 8704
208XC1SOFTWAREHIS O:40BINDING SITE FOR RESIDUE CD O 8705
209XC2SOFTWAREASN J:126 , ILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 8801
210XC3SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 8802
211XC4SOFTWAREG 0:1676BINDING SITE FOR RESIDUE CL 0 8803
212XC5SOFTWARETHR 3:65 , ASP 3:66BINDING SITE FOR RESIDUE CL 3 8804
213XC6SOFTWAREG 0:201 , G 0:229BINDING SITE FOR RESIDUE CL 0 8805
214XC7SOFTWAREHOH 0:9160 , LYS R:118BINDING SITE FOR RESIDUE CL R 8806
215XC8SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 8807
216XC9SOFTWAREASN O:44 , ARG O:47BINDING SITE FOR RESIDUE CL O 8808
217YC1SOFTWARELYS A:178BINDING SITE FOR RESIDUE CL A 8809
218YC2SOFTWAREARG L:53 , GLN L:58BINDING SITE FOR RESIDUE CL L 8810
219YC3SOFTWAREC 0:2388 , HOH 0:9993 , HIS Q:53 , PHE Q:56 , HOH Q:3082BINDING SITE FOR RESIDUE CL Q 8811
220YC4SOFTWAREG 0:2582 , A 0:2596 , HOH 0:4953 , LYS K:14 , SER K:33BINDING SITE FOR RESIDUE CL 0 8812
221YC5SOFTWAREG 0:1300 , A 0:1328 , A 0:1329 , HOH 0:4515BINDING SITE FOR RESIDUE CL 0 8813
222YC6SOFTWAREG 0:644 , HIS L:13 , HOH L:8895BINDING SITE FOR RESIDUE CL 0 8814
223YC7SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 8815
224YC8SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 8816
225YC9SOFTWAREC 0:594 , U 0:595 , HOH Y:8137BINDING SITE FOR RESIDUE CL 0 8817
226ZC1SOFTWARESER M:106 , VAL M:114 , ARG M:158 , VAL M:159BINDING SITE FOR RESIDUE CL M 8818
227ZC2SOFTWAREARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 8819
228ZC3SOFTWAREG 0:1269 , ARG Y:169BINDING SITE FOR RESIDUE CL 0 8820
229ZC4SOFTWAREHOH 0:5614 , GLY J:64 , ASN J:65 , GLY J:68 , TYR J:69BINDING SITE FOR RESIDUE CL J 8821
230ZC5SOFTWAREG 0:1072 , G 0:1087BINDING SITE FOR RESIDUE CL 0 8822
231ZC6SOFTWAREG 0:24 , U 0:510 , A 0:511 , U 0:517 , G 0:518 , U 0:1338 , HOH 0:7683 , MG 0:8089BINDING SITE FOR RESIDUE NEG 0 8823

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QEX)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:111-127
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:126-140
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 2QEX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                2qex 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d2qex11 1:1-56 50S subunit                               SCOP domains
               CATH domains 2qex100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-2qex101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhh.......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                2qex 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d2qex21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 2qex200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-2qex201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                2qex 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d2qex31 3:1-92 50S subunit                                                                   SCOP domains
               CATH domains 2qex300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                2qex 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                2qex 9 3001 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC 3122
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100      3110      3120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qexA01 A:1-78 Nucleic acid-binding proteins                                  ---2qexA02 A:82-159  [code=2.30.30.30, no name defined]                          2qexA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-2qexA02 A:10-82                                             -----Ribosomal_L2_C-2qexA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh..............eeeeeeeeee......eeeeeee....eeee..........eeee..........eee........eee...................eee.......eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhh...................ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d2qexb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2qexB01 B:1-38,B:207-257              2qexB02 B:39-77,B:189-206,B:258-337    2qexB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         2qexB02           2qexB01 B:1-38,B:207-257                           2qexB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-2qexB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeee.......hhhhh.........hhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee.....eehhhhhhh....hhhhhhh........................ee....eeeeeeeeeeeee....................eeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d2qexc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 2qexC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-2qexC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhh.............................................................hhhhhhhhhhhhhhhh.hhhhhhhh..........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee....hhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2qex C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d2qexd1 D:10-174 50S      subunit                                                                                                                                     SCOP domains
               CATH domains 2qexD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-2qexD0     1 D:11-64                     ---Ribosomal_L5_C-2qexD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author hhhhhh.eeeeeeeee....-----..hhhhhhhhhh...eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee...hhhhhh.............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qexE01 E:1-79  [code=3.90.930.12, no name defined]                            2qexE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-2qexE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-2qexE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d2qexf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 2qexF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-2qexF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhh....eeee....hhhhh.hhhhhhhh....eeee.hhhhhhhhh.......eeee.....hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                2qex F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d2qexg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                2qex G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d2qexh1 H:1-163 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 2qexH00 H:1-171  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh................................hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh....eeeee.....eee....-----------...........eeeeee....eeeeeee...hhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex H    1 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA  171
                                    10        20        30        40        50        60        70        80        90        |-         -|      120       130       140       150       160       170 
                                                                                                                             99         111                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d2qexi1 I:71-134 Ribosomal protein L11, C-terminal domain       ------ SCOP domains
               CATH domains 2qexI00 I:71-140  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-2qexI01 I:71-139                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhhh..............eeehhhhhhhhhhh........hhhhhhhhhhh......eee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                2qex I   71 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  140
                                    80        90       100       110       120       130       140

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d2qexj1 J:4-145 50S subunit                                                                                                                    SCOP domains
               CATH domains 2qexJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-2qexJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d2qexk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 2qexK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-2qexK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eee....eeeee.............eee.hhh..hhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2qex K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d2qexl1 L:1-150 50S subunit                                                                                                                            SCOP domains
               CATH domains 2qexL01 L:1-50                                    2qexL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-2qexL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhh...eeee.hhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2qex L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d2qexm1 M:1-194 Ribosomal protein L15e                                                                                                                                                             SCOP domains
               CATH domains 2qexM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-2qexM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eee.....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d2qexn1 N:1-186 50S subunit                                                                                                                                                                SCOP domains
               CATH domains 2qexN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-2qexN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2qex N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d2qexo1 O:1-115 50S subunit                                                                                         SCOP domains
               CATH domains 2qexO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-2qexO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....eeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                2qex O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d2qexp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 2qexP01 P:1-55  [code=1.10.1650.10, no name defined]   2qexP02 P:56-88 Single Heli x bin2qexP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhh..hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d2qexq1 Q:1-95 50S subunit                                                                      SCOP domains
               CATH domains 2qexQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-2qexQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh...hhhhhh.......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                2qex Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d2qexr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 2qexR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-2qexR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhh........eeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2qex R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d2qexs1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 2qexS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-2qexS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                2qex S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d2qext1 T:1-119 50S subunit                                                                                             SCOP domains
               CATH domains 2qexT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-2qexT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                2qex T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d2qexu1 U:4-56 50S subunit                            SCOP domains
               CATH domains 2qexU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-2qexU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                2qex U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d2qexv1 V:1-65 50S subunit                                        SCOP domains
               CATH domains 2qexV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-2qexV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                2qex V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d2qexw1 W:1-154 50S subunit                                                                                                                                SCOP domains
               CATH domains 2qexW01 W:1-57,W:114-154                                 2qexW02 W:58-113  [code=1.10.15.30, no name defined]    2qexW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-2qexW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eee...hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.....................ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d2qexx1 X:7-88 50S subunit                                                         SCOP domains
               CATH domains 2qexX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-2qexX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhh..hhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhh.........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                2qex X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d2qexy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-2qexY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author ..eee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qex Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d2qexz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 2qexZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-2qexZ01 Z:11-82                                          Pfam domains
         Sec.struct. author .hhhhh...hhhhhhhhhhhhhhhh..ee......eeeeeee..eeee.....eee.......hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                2qex Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (15, 27)

Asymmetric/Biological Unit
13ad2qex111:1-56
13bd2qex313:1-92
13cd2qexd1D:10-174
13dd2qexj1J:4-145
13ed2qexl1L:1-150
13fd2qexn1N:1-186
13gd2qexo1O:1-115
13hd2qexq1Q:1-95
13id2qext1T:1-119
13jd2qexu1U:4-56
13kd2qexv1V:1-65
13ld2qexw1W:1-154
13md2qexx1X:7-88
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qex
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P606171ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P158251jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P141221c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P291981ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P224501c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P606181ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P127371ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P127331ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P141231ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P141191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P127341ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P109701ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P127321ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P141161ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P109721ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P109711ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P202761c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P141211ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P181381ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P127361ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P606191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P324101ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P224521ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P202791ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P324111ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P127351ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P141241ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P141351c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P127431ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QEX)