Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF QUINUPRISTIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Date :  15 Jan 05  (Deposition) - 26 Apr 05  (Release) - 27 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,7#,8#,9
Biol. Unit 1:  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,9  (1x)
#:   chains that contain no standard or modified protein/DNA/RNA residue)
 
Keywords :  Quinupristin, Dalfopristin, Streptogramin, Antibiotic, Mutated 50S Subunits, Ribosome, Ribosome-Antibiotic Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Structures Of Mlsbk Antibiotics Bound To Mutated Large Ribosomal Subunits Provide A Structural Explanation For Resistance.
Cell(Cambridge, Mass. ) V. 121 257 2005
PubMed-ID: 15851032  |  Reference-DOI: 10.1016/J.CELL.2005.02.005

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    EngineeredYES
    MutationYES
    Other DetailsENCODED BY RRNA OPERON
    SyntheticYES
 
Molecule 2 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 5 - QUINUPRISTIN
    Chains4
    EngineeredYES
    Organism ScientificSTREPTOMYCES GRAMINOFACIEN
    Organism Taxid68212
    SyntheticYES
 
Molecule 6 - 5S RIBOSOMAL RNA
    Chains9
    EngineeredYES
    SyntheticYES
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L4E
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 13 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41
 
Molecule 32 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT41

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031323334
Asymmetric Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ012347#8#9
Biological Unit 1 (1x)ABCDEFGHIJKLMNOPQRSTUVWXYZ01234  9
#:   chains that contain no standard or modified protein/DNA/RNA residue)
 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (16, 243)

Asymmetric Unit (16, 243)
No.NameCountTypeFull Name
10041Mod. Amino Acid(2S)-AMINO(PHENYL)ETHANOIC ACID
21MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
3CD5Ligand/IonCADMIUM ION
4CL22Ligand/IonCHLORIDE ION
5DBB1Mod. Amino AcidD-ALPHA-AMINOBUTYRIC ACID
6K2Ligand/IonPOTASSIUM ION
7MG117Ligand/IonMAGNESIUM ION
8MHT1Mod. Amino Acid(3R)-3-(METHYLSULFANYL)-1-AZABICYCLO[2.2.2]OCTANE
9MHU1Mod. Amino Acid4-N,N-(DIMETHYLAMINO)-L-PHENYLALANINE
10MHV1Mod. Amino Acid4-OXO-L-PIPECOLIC ACID
11MHW1Mod. Amino Acid3-HYDROXYPICOLINIC ACID
12NA86Ligand/IonSODIUM ION
13OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
14OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
15PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
16UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE
Biological Unit 1 (11, 11)
No.NameCountTypeFull Name
10041Mod. Amino Acid(2S)-AMINO(PHENYL)ETHANOIC ACID
21MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
3CD-1Ligand/IonCADMIUM ION
4CL-1Ligand/IonCHLORIDE ION
5DBB1Mod. Amino AcidD-ALPHA-AMINOBUTYRIC ACID
6K-1Ligand/IonPOTASSIUM ION
7MG-1Ligand/IonMAGNESIUM ION
8MHT1Mod. Amino Acid(3R)-3-(METHYLSULFANYL)-1-AZABICYCLO[2.2.2]OCTANE
9MHU1Mod. Amino Acid4-N,N-(DIMETHYLAMINO)-L-PHENYLALANINE
10MHV1Mod. Amino Acid4-OXO-L-PIPECOLIC ACID
11MHW1Mod. Amino Acid3-HYDROXYPICOLINIC ACID
12NA-1Ligand/IonSODIUM ION
13OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
14OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
15PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
16UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (233, 233)

Asymmetric Unit (233, 233)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:9077 , HOH 0:9083 , HOH 0:9181BINDING SITE FOR RESIDUE MG 78001
002AC2SOFTWAREU 0:626 , G 0:627 , A 0:2483 , C 0:2534 , HOH 0:5404 , HOH 0:9082 , HOH 0:9183BINDING SITE FOR RESIDUE MG 78002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:9435 , HOH A:4079 , HOH A:4080BINDING SITE FOR RESIDUE MG 78003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:5092 , HOH 0:5093 , HOH 0:5096 , HOH 0:5106BINDING SITE FOR RESIDUE MG 78004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:7931 , HOH 0:7933 , HOH 0:7942BINDING SITE FOR RESIDUE MG 78005
006AC6SOFTWAREU 0:821 , C 0:822 , G 0:854 , HOH 0:5832 , HOH 0:5945 , HOH 0:5951BINDING SITE FOR RESIDUE MG 78006
007AC7SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:5865 , HOH 0:7943 , HOH 0:7947BINDING SITE FOR RESIDUE MG 78007
008AC8SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:6154 , HOH 0:6155 , HOH 0:9018BINDING SITE FOR RESIDUE MG 78008
009AC9SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:8441 , HOH 0:9381 , HOH 0:9382 , HOH 0:9385BINDING SITE FOR RESIDUE MG 78009
010BC1SOFTWAREG 0:836 , U 0:2615 , HOH 0:5884 , HOH 0:9397 , HOH 0:9401 , GLN B:230BINDING SITE FOR RESIDUE MG 78010
011BC2SOFTWAREG 0:824 , G 0:854 , HOH 0:5841 , HOH 0:5842 , HOH 0:5941 , HOH 0:5943BINDING SITE FOR RESIDUE MG 78011
012BC3SOFTWAREG 0:28 , U 0:1304 , G 0:1344 , HOH 0:4077 , HOH 0:4078 , HOH 0:6860 , HOH 0:6885BINDING SITE FOR RESIDUE MG 78012
013BC4SOFTWAREG 0:877 , G 0:2623 , HOH 0:6015 , HOH 0:6017 , HOH 0:9058 , HOH 0:9431BINDING SITE FOR RESIDUE MG 78013
014BC5SOFTWAREA 0:2101 , G 0:2102 , G 0:2537 , HOH 0:8468 , HOH 0:9071 , HOH 0:9188 , HOH 0:9190BINDING SITE FOR RESIDUE MG 78014
015BC6SOFTWAREA 0:844 , A 0:1689 , HOH 0:5913 , HOH 0:7606 , HOH 0:7619 , HOH 1:4004BINDING SITE FOR RESIDUE MG 78015
016BC7SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:7336 , HOH 0:7578 , HOH 0:7579BINDING SITE FOR RESIDUE MG 78016
017BC8SOFTWAREG 0:456 , HOH 0:5094 , HOH 0:5099 , HOH 0:5100 , HOH 0:5103 , HOH C:4068BINDING SITE FOR RESIDUE MG 78017
018BC9SOFTWAREA 0:1291 , G 0:1292 , HOH 0:6813 , HOH 0:6817 , HOH 0:6818 , HOH 0:6821BINDING SITE FOR RESIDUE MG 78018
019CC1SOFTWAREA 0:2011 , HOH 0:8083 , HOH 0:8084 , HOH 0:8085 , HOH 0:8123 , HOH 0:8234BINDING SITE FOR RESIDUE MG 78019
020CC2SOFTWAREC 0:1830 , HOH 0:7913 , HOH 0:7918 , HOH 0:7919 , HOH 0:7921 , HOH 0:7953BINDING SITE FOR RESIDUE MG 78020
021CC3SOFTWAREG 0:2304 , HOH 0:8688 , HOH 0:8696 , HOH 0:8699 , HOH 0:8701 , HOH 0:8704BINDING SITE FOR RESIDUE MG 78021
022CC4SOFTWAREG 0:2097 , G 0:2540 , HOH 0:8448 , HOH 0:8450 , HOH 0:8454 , HOH 0:9204BINDING SITE FOR RESIDUE MG 78022
023CC5SOFTWAREG 0:2616 , G 0:2617 , G 0:2618 , HOH 0:9402 , HOH 0:9404 , HOH 0:9407 , HOH 0:9408BINDING SITE FOR RESIDUE MG 78023
024CC6SOFTWAREA 0:1381 , HOH 0:7061 , HOH 0:7063 , HOH 0:7064 , HOH 0:9674BINDING SITE FOR RESIDUE MG 78024
025CC7SOFTWAREU 0:1120 , G 0:1121 , HOH 0:6563 , HOH 0:6567 , HOH 0:6568 , HOH 0:6729BINDING SITE FOR RESIDUE MG 78025
026CC8SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:9367 , HOH 0:9371 , HOH 0:9372 , HOH 0:9377BINDING SITE FOR RESIDUE MG 78026
027CC9SOFTWAREC 0:240 , G 0:269 , HOH 0:4761 , HOH 0:4763 , HOH 0:4822 , HOH 0:4823BINDING SITE FOR RESIDUE MG 78027
028DC1SOFTWAREA 0:1448 , U 0:1677 , HOH 0:7211 , HOH 0:7214 , HOH 0:7573 , HOH S:4022BINDING SITE FOR RESIDUE MG 78028
029DC2SOFTWAREA 0:1502 , U 0:1503 , A 0:1504 , C 0:1679 , HOH 0:7333 , HOH 0:7334 , HOH 0:7337 , HOH 0:7577BINDING SITE FOR RESIDUE MG 78029
030DC3SOFTWAREU 0:1748 , U 0:1749 , HOH 0:7766 , HOH 0:7771 , HOH 0:7772 , HOH 0:7778BINDING SITE FOR RESIDUE MG 78030
031DC4SOFTWAREU 0:777 , C 0:778 , HOH 0:5745 , HOH 0:5746 , HOH 0:5748 , HOH 0:5749 , NA 8:8525BINDING SITE FOR RESIDUE MG 78031
032DC5SOFTWAREU 0:2115 , G 0:2272 , HOH 0:8514 , HOH 0:8601 , HOH 0:8602 , HOH A:4081 , HOH A:4082BINDING SITE FOR RESIDUE MG 78032
033DC6SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:7775 , HOH 0:9308BINDING SITE FOR RESIDUE MG 78033
034DC7SOFTWAREA 0:2302 , A 0:2303 , HOH 0:8685 , HOH 0:8689 , HOH 0:8690 , HOH 0:8695BINDING SITE FOR RESIDUE MG 78034
035DC8SOFTWAREG 0:1484 , HOH 0:7233 , HOH 0:7235 , HOH 0:7237 , HOH 0:7289 , HOH 0:7290BINDING SITE FOR RESIDUE MG 78035
036DC9SOFTWAREG 0:956 , HOH 0:6242 , HOH 0:6243 , HOH 0:6245 , HOH 0:6246 , HOH 0:6278BINDING SITE FOR RESIDUE MG 78036
037EC1SOFTWAREA 0:2553 , A 0:2576 , HOH 0:9244 , HOH 0:9245 , HOH 0:9246 , HOH 0:9248 , HOH 0:9281BINDING SITE FOR RESIDUE MG 78037
038EC2SOFTWAREHOH 0:4645 , HOH 0:8511 , HOH 0:8515 , HOH 0:8597 , HOH 0:8607 , HOH 0:8610BINDING SITE FOR RESIDUE MG 78038
039EC3SOFTWAREU 0:115 , G 0:118 , HOH 0:4328 , HOH 0:4330 , HOH 0:4332 , HOH 0:4340 , HOH 0:4341BINDING SITE FOR RESIDUE MG 78039
040EC4SOFTWAREU 0:392 , HOH 0:4509 , HOH 0:4971 , HOH 0:4972 , HOH 0:4973 , HOH 0:4975BINDING SITE FOR RESIDUE MG 78040
041EC5SOFTWAREC 0:195 , G 0:196 , A 0:227 , C 0:228 , HOH 0:4609 , HOH 0:4611 , HOH 0:5016BINDING SITE FOR RESIDUE MG 78041
042EC6SOFTWAREU 0:1309 , U 0:1346 , HOH 0:6871 , HOH 0:6872 , HOH 0:6954 , HOH 0:6955BINDING SITE FOR RESIDUE MG 78042
043EC7SOFTWAREG 0:816 , G 0:817 , HOH 0:5785 , HOH 0:5818 , HOH 0:5819BINDING SITE FOR RESIDUE MG 78043
044EC8SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:8316 , GLY R:65 , HOH R:4037BINDING SITE FOR RESIDUE MG 78044
045EC9SOFTWAREG 0:1979 , HOH 0:8166 , HOH 0:8172 , HOH 0:8216 , HOH 0:8218BINDING SITE FOR RESIDUE MG 78045
046FC1SOFTWAREG 0:1794 , HOH 0:7853 , HOH 0:7862 , HOH 0:7863BINDING SITE FOR RESIDUE MG 78046
047FC2SOFTWAREA 0:1098 , G 0:1099 , HOH 0:6518 , HOH 0:6521 , HOH 0:6522BINDING SITE FOR RESIDUE MG 78047
048FC3SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:9668 , HOH 0:9669 , HOH 0:9676BINDING SITE FOR RESIDUE MG 78048
049FC4SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8875BINDING SITE FOR RESIDUE MG 78049
050FC5SOFTWAREC 0:2248 , HOH 0:8563BINDING SITE FOR RESIDUE MG 78050
051FC6SOFTWAREG 0:641 , HOH 0:5468 , HOH 0:5469 , HOH 0:6982BINDING SITE FOR RESIDUE MG 78051
052FC7SOFTWAREU 0:1125 , C 0:1129 , HOH 0:6577 , HOH 0:6586 , G 9:92 , HOH 9:4107 , HOH 9:4108BINDING SITE FOR RESIDUE MG 78052
053FC8SOFTWAREG 0:471 , HOH 0:5137 , HOH 0:5138 , HOH 0:5145 , HOH 0:6033 , HOH 0:6058BINDING SITE FOR RESIDUE MG 78053
054FC9SOFTWAREC 0:162 , U 0:2276 , HOH 0:4478 , HOH 0:4479 , HOH 0:4481 , HOH 0:4501BINDING SITE FOR RESIDUE MG 78054
055GC1SOFTWAREA 0:2757 , HOH 0:9613 , HOH 0:9694 , ASN B:335 , HOH B:4140 , HOH B:4144BINDING SITE FOR RESIDUE MG 78056
056GC2SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:8066 , MG 7:8058 , GLN A:207 , HOH A:4095BINDING SITE FOR RESIDUE MG 78057
057GC3SOFTWAREU 0:1883 , G 0:2013 , HOH 0:8064 , HOH 0:8067 , HOH 0:8239 , MG 7:8057 , HOH A:4095 , HOH A:4096BINDING SITE FOR RESIDUE MG 78058
058GC4SOFTWAREG 0:2618 , HOH 0:9410 , HOH 0:9411 , HOH 0:9488 , HOH 0:9491 , HOH 0:9492 , MG 7:8085BINDING SITE FOR RESIDUE MG 78059
059GC5SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:4524 , HOH 0:4533 , HOH 0:4535 , HOH 0:4980BINDING SITE FOR RESIDUE MG 78060
060GC6SOFTWAREA 0:1369 , U 0:2650 , HOH 0:7030 , HOH 0:7031 , HOH 0:7032 , HOH 0:9512BINDING SITE FOR RESIDUE MG 78061
061GC7SOFTWAREG 0:1489 , G 0:1491 , HOH 0:7298 , HOH 0:7300 , HOH 0:7304 , HOH 0:7305BINDING SITE FOR RESIDUE MG 78062
062GC8SOFTWAREHOH 0:4204 , HOH 0:4398 , HOH 0:4400 , HOH 0:7013 , HOH 0:7014 , HOH 0:7016BINDING SITE FOR RESIDUE MG 78063
063GC9SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:4642 , HOH 0:8505 , HOH 0:8510 , HOH 0:8618BINDING SITE FOR RESIDUE MG 78064
064HC1SOFTWAREC 0:1872 , G 0:1873 , HOH 0:8040 , HOH 0:8041 , ASP A:26BINDING SITE FOR RESIDUE MG 78066
065HC2SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8065 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 78067
066HC3SOFTWAREA 0:2568 , HOH 0:9263 , HOH 0:9265 , HOH 0:9268 , HOH 0:9269 , HOH E:4036BINDING SITE FOR RESIDUE MG 78068
067HC4SOFTWAREA 0:166 , G 0:219 , HOH 0:4689 , HOH 0:4691 , HOH 0:9032BINDING SITE FOR RESIDUE MG 78070
068HC5SOFTWAREA 0:1815 , HOH 0:4530 , HOH 0:7884 , HOH 0:7890 , HOH 0:7891 , HOH 0:7895 , HOH 0:7896BINDING SITE FOR RESIDUE MG 78071
069HC6SOFTWAREU 0:954 , HOH 0:6233 , HOH 0:8673 , HOH 0:8675 , HOH 0:8681 , HOH 0:8684BINDING SITE FOR RESIDUE MG 78072
070HC7SOFTWAREA 0:1286 , A 0:1287 , HOH 0:6803 , HOH 0:6804 , HOH W:4029 , HOH W:4033BINDING SITE FOR RESIDUE MG 78074
071HC8SOFTWAREA 0:907 , A 0:908 , HOH 0:6123 , HOH 0:6788 , HOH 0:6791 , HOH 0:6915BINDING SITE FOR RESIDUE MG 78075
072HC9SOFTWAREHOH 0:4415 , HOH 0:7142 , HOH 0:7199BINDING SITE FOR RESIDUE MG 78076
073IC1SOFTWAREC 0:880 , U 0:883 , HOH 0:6029 , HOH 0:6030 , HOH 0:6031 , HOH 0:6034BINDING SITE FOR RESIDUE MG 78077
074IC2SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:4485 , HOH 0:4486 , HOH 0:4487BINDING SITE FOR RESIDUE MG 78079
075IC3SOFTWAREA 0:1684 , U 0:1724 , HOH 0:7173 , HOH 0:7586 , HOH 0:7588 , HOH 0:7590 , HOH 0:7614BINDING SITE FOR RESIDUE MG 78080
076IC4SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:7147 , HOH 0:7152BINDING SITE FOR RESIDUE MG 78081
077IC5SOFTWAREC 0:1436 , A 0:1437 , HOH 0:7157 , HOH 0:7158 , HOH 0:7184BINDING SITE FOR RESIDUE MG 78082
078IC6SOFTWAREA 0:1754 , HOH 0:7792 , HOH 0:7794 , HOH 0:7797 , HOH 0:7800 , HOH 0:7803BINDING SITE FOR RESIDUE MG 78083
079IC7SOFTWAREA 0:1742 , G 0:1745 , HOH 0:7748 , HOH 0:7751 , HOH 0:7752 , HOH 0:8281 , HOH 0:8282BINDING SITE FOR RESIDUE MG 78084
080IC8SOFTWAREG 0:2617 , G 0:2618 , HOH 0:9406 , HOH 0:9483 , HOH 0:9485 , HOH 0:9488 , HOH 0:9490 , MG 7:8059BINDING SITE FOR RESIDUE MG 78085
081IC9SOFTWAREA 0:532 , U 0:533 , HOH 0:4002 , HOH 0:5260 , HOH 0:5264 , HOH 0:5265BINDING SITE FOR RESIDUE MG 78086
082JC1SOFTWAREA 0:682 , G 0:683 , HOH 0:5556BINDING SITE FOR RESIDUE MG 78087
083JC2SOFTWAREG 0:2540 , G 0:2611 , G 0:2646 , HOH 0:9202 , HOH 0:9396 , HOH 0:9503 , HOH 0:9504 , NA 8:8539BINDING SITE FOR RESIDUE MG 78088
084JC3SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:5225 , HOH 0:5229 , HOH 0:5231BINDING SITE FOR RESIDUE MG 78089
085JC4SOFTWAREA 0:2103 , U 0:2478 , HOH 0:8473 , HOH 0:9064 , HOH 0:9068BINDING SITE FOR RESIDUE MG 78090
086JC5SOFTWAREG 0:918 , HOH 0:6150 , HOH 0:8660 , HOH 0:8668 , HOH 0:9021 , HOH 0:9022BINDING SITE FOR RESIDUE MG 78091
087JC6SOFTWAREC 0:1844 , HOH 0:4560 , HOH 0:7957 , HOH 0:7961 , HOH 0:7962BINDING SITE FOR RESIDUE MG 78092
088JC7SOFTWAREG 0:627 , A 0:1070 , G 0:1071 , HOH 0:5405 , HOH 0:6138 , HOH 0:6140 , HOH 0:6449BINDING SITE FOR RESIDUE MG 78093
089JC8SOFTWAREU 0:1096 , C 0:1257 , G 0:1258 , HOH 0:6760 , HOH 0:6761BINDING SITE FOR RESIDUE MG 78094
090JC9SOFTWAREG 0:1848 , G 0:1849 , HOH 0:7965 , HOH 0:7969 , HOH 0:7974 , HOH 0:8063 , MG 7:8115BINDING SITE FOR RESIDUE MG 78096
091KC1SOFTWAREG 0:863 , U 0:864 , HOH 0:5757 , HOH 0:5969 , HOH 0:5977 , HOH 0:5980BINDING SITE FOR RESIDUE MG 78097
092KC2SOFTWAREA 0:907 , HOH 0:6119 , HOH 0:6120 , HOH 0:6121 , HOH 0:6124 , HOH Y:4054BINDING SITE FOR RESIDUE MG 78098
093KC3SOFTWAREA 0:2612 , HOH 0:4790 , HOH 0:9387 , HOH 0:9507BINDING SITE FOR RESIDUE MG 78099
094KC4SOFTWAREG 0:2080 , HOH 0:4185 , HOH 0:4638 , HOH 0:8370 , HOH 0:8409BINDING SITE FOR RESIDUE MG 78100
095KC5SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:8487 , HOH 0:8628 , HOH 0:8634BINDING SITE FOR RESIDUE MG 78101
096KC6SOFTWAREA 0:2434 , U 0:2458 , HOH 0:8953 , HOH 0:8954 , HOH 0:8999BINDING SITE FOR RESIDUE MG 78102
097KC7SOFTWAREG 0:2578 , G 0:2579 , HOH 0:9283BINDING SITE FOR RESIDUE MG 78103
098KC8SOFTWAREC 0:2104 , C 0:2105 , HOH 0:9049 , HOH 0:9050BINDING SITE FOR RESIDUE MG 78104
099KC9SOFTWAREG 0:795 , G 0:817 , HOH 0:5814 , HOH 0:5819 , SER P:90 , HOH P:4047BINDING SITE FOR RESIDUE MG 78105
100LC1SOFTWAREC 0:1103 , A 0:1106 , A 0:1107 , HOH 0:6530 , HOH 0:6534 , HOH 0:6535 , HOH 0:6538BINDING SITE FOR RESIDUE MG 78106
101LC2SOFTWAREG 0:2001 , HOH 0:4601 , HOH 0:8163 , HOH 0:8165 , HOH 0:8219 , HOH 0:8220BINDING SITE FOR RESIDUE MG 78107
102LC3SOFTWAREU 0:903 , A 0:1357 , HOH 0:6111 , HOH 0:6113 , HOH 0:6988 , HOH 0:6992BINDING SITE FOR RESIDUE MG 78109
103LC4SOFTWAREG 0:2609 , HOH 0:4789 , HOH 0:9357 , HOH 0:9358 , HOH 0:9375 , HOH 0:9378BINDING SITE FOR RESIDUE MG 78110
104LC5SOFTWAREA 0:187 , HOH 0:4454 , HOH 0:4455 , HOH 0:4586 , HOH 0:4648 , HOH 0:5058BINDING SITE FOR RESIDUE MG 78111
105LC6SOFTWAREA 0:2112 , HOH 0:4642 , HOH 0:8498 , HOH 0:8502 , HOH 0:8503 , HOH 0:8505BINDING SITE FOR RESIDUE MG 78112
106LC7SOFTWAREA 0:2430 , HOH 0:4697 , HOH 0:8938 , HOH 0:8939 , HOH 0:8944 , HOH 0:9035BINDING SITE FOR RESIDUE MG 78113
107LC8SOFTWAREHOH 0:4565 , HOH 0:4568 , HOH 0:7967 , HOH 0:7970 , HOH 0:7973BINDING SITE FOR RESIDUE MG 78114
108LC9SOFTWAREG 0:1849 , U 0:1850 , HOH 0:4565 , HOH 0:7969 , HOH 0:7974 , HOH 0:7975 , HOH 0:7976 , MG 7:8096BINDING SITE FOR RESIDUE MG 78115
109MC1SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:7928 , HOH 0:8254 , HOH 0:8255BINDING SITE FOR RESIDUE MG 78116
110MC2SOFTWAREHOH 0:8471 , HOH 0:9421 , MHW 4:1 , HOH 4:4001 , HOH 4:4002BINDING SITE FOR RESIDUE MG 78117
111MC3SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 78401
112MC4SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:4474 , HOH 0:4506 , ARG M:82BINDING SITE FOR RESIDUE K 78402
113MC5SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:6444 , HOH 0:6446 , HOH 0:6493BINDING SITE FOR RESIDUE NA 88501
114MC6SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:6563BINDING SITE FOR RESIDUE NA 88502
115MC7SOFTWAREA 0:643 , G 0:644 , U 0:904 , C 0:1353 , G 0:1354 , ARG L:8BINDING SITE FOR RESIDUE NA 88503
116MC8SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:5424 , HOH 0:8390 , HOH 0:8398BINDING SITE FOR RESIDUE NA 88505
117MC9SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649BINDING SITE FOR RESIDUE NA 88506
118NC1SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 88507
119NC2SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:7700BINDING SITE FOR RESIDUE NA 88508
120NC3SOFTWAREA 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , THR H:161 , PRO H:162BINDING SITE FOR RESIDUE NA 88509
121NC4SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:9285BINDING SITE FOR RESIDUE NA 88510
122NC5SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:9160 , HOH 0:9162 , HOH 0:9164BINDING SITE FOR RESIDUE NA 88511
123NC6SOFTWAREG 0:2399 , G 0:2400 , HOH 0:8829 , HOH 0:8858 , HOH 0:8860 , HOH 0:8868 , HOH 0:8869BINDING SITE FOR RESIDUE NA 88513
124NC7SOFTWAREU 0:2541 , U 0:2607 , HOH 0:9365 , TRP B:242BINDING SITE FOR RESIDUE NA 88514
125NC8SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:4484BINDING SITE FOR RESIDUE NA 88515
126NC9SOFTWAREC 0:896 , A 0:897 , HOH 0:4064 , HOH 0:4482 , HOH 0:8494BINDING SITE FOR RESIDUE NA 88516
127OC1SOFTWAREG 0:1416 , G 0:1417 , HOH 0:7593 , TRP 2:42 , ASN 2:45 , HOH 2:4037BINDING SITE FOR RESIDUE NA 88517
128OC2SOFTWAREG 0:2543 , G 0:2544 , HOH 0:9217 , HOH 0:9226 , NA 8:8520BINDING SITE FOR RESIDUE NA 88518
129OC3SOFTWAREA 0:2465 , G 0:2466 , HOH 0:9023 , HOH 0:9024 , ASP L:36 , HOH L:4034BINDING SITE FOR RESIDUE NA 88519
130OC4SOFTWAREG 0:2543 , G 0:2544 , U 0:2615 , HOH 0:9391 , HOH 0:9398 , NA 8:8518BINDING SITE FOR RESIDUE NA 88520
131OC5SOFTWAREG 0:836 , U 0:837 , A 0:1736 , A 0:1737 , ARG B:229BINDING SITE FOR RESIDUE NA 88521
132OC6SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:6054 , HOH 0:8504BINDING SITE FOR RESIDUE NA 88523
133OC7SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:4369BINDING SITE FOR RESIDUE NA 88524
134OC8SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:5746 , HOH 0:5749 , HOH 0:5753 , HOH 0:5982 , MG 7:8031BINDING SITE FOR RESIDUE NA 88525
135OC9SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 88526
136PC1SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:5938BINDING SITE FOR RESIDUE NA 88527
137PC2SOFTWAREG 0:56 , A 0:59 , G 0:61 , C 0:62 , HOH 0:4184BINDING SITE FOR RESIDUE NA 88528
138PC3SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:4213BINDING SITE FOR RESIDUE NA 88529
139PC4SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:4410BINDING SITE FOR RESIDUE NA 88530
140PC5SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221BINDING SITE FOR RESIDUE NA 88531
141PC6SOFTWAREG 0:386 , G 0:387 , G 0:388 , U 0:402 , HOH 0:4140BINDING SITE FOR RESIDUE NA 88532
142PC7SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE NA 88533
143PC8SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:8092BINDING SITE FOR RESIDUE NA 88534
144PC9SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , A 0:632 , HOH 0:5421BINDING SITE FOR RESIDUE NA 88535
145QC1SOFTWAREG 0:1706 , G 0:1707 , HOH 0:7652 , HOH 0:7656 , HOH 0:7661 , HOH 0:7662BINDING SITE FOR RESIDUE NA 88536
146QC2SOFTWAREU 0:2659 , G 0:2660 , HOH 0:9543 , VAL R:72 , TRP R:75 , HOH R:4041 , NA R:8537BINDING SITE FOR RESIDUE NA 88538
147QC3SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , HOH 0:9395 , HOH 0:9396 , MG 7:8088BINDING SITE FOR RESIDUE NA 88539
148QC4SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:4516BINDING SITE FOR RESIDUE NA 88540
149QC5SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:5557BINDING SITE FOR RESIDUE NA 88541
150QC6SOFTWAREG 0:892 , C 0:893 , HOH 0:6072 , HOH 0:6073 , HOH 0:6077BINDING SITE FOR RESIDUE NA 88542
151QC7SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:4032BINDING SITE FOR RESIDUE NA 88543
152QC8SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:9549BINDING SITE FOR RESIDUE NA 88544
153QC9SOFTWAREA 0:914 , C 0:915 , C 0:1043 , G 0:1045BINDING SITE FOR RESIDUE NA 88549
154RC1SOFTWAREU 0:623 , U 0:624 , C 0:633 , G 0:901BINDING SITE FOR RESIDUE NA 88550
155RC2SOFTWAREA 0:955 , HOH 0:6241 , C 9:81 , U 9:82BINDING SITE FOR RESIDUE NA 88552
156RC3SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:6336 , HOH 0:6344 , GLY L:14BINDING SITE FOR RESIDUE NA 88553
157RC4SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5719BINDING SITE FOR RESIDUE NA 88554
158RC5SOFTWAREG 0:1119 , C 0:1243 , THR J:47 , HOH J:4011BINDING SITE FOR RESIDUE NA 88555
159RC6SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , A 0:2467 , HOH 0:8616BINDING SITE FOR RESIDUE NA 88556
160RC7SOFTWAREG 0:941 , U 0:942 , G 0:1024 , C 0:1025 , HOH 0:6303BINDING SITE FOR RESIDUE NA 88557
161RC8SOFTWAREG 0:2611 , HOH 0:8444 , TRP B:242BINDING SITE FOR RESIDUE NA 88558
162RC9SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 88559
163SC1SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5164BINDING SITE FOR RESIDUE NA 88560
164SC2SOFTWAREU 0:837 , HOH 0:4256 , HOH 0:5889 , HOH 0:5892 , GLN B:230 , HOH B:4097BINDING SITE FOR RESIDUE NA 88561
165SC3SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277BINDING SITE FOR RESIDUE NA 88562
166SC4SOFTWAREU 0:1359 , C 0:1360 , HOH 0:5447BINDING SITE FOR RESIDUE NA 88563
167SC5SOFTWAREG 0:636 , U 0:2057 , G 0:2058 , HOH 0:5446 , HOH 0:8347BINDING SITE FOR RESIDUE NA 88564
168SC6SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 88565
169SC7SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:5292 , HOH 0:5369 , HOH 0:5372BINDING SITE FOR RESIDUE NA 88566
170SC8SOFTWAREG 0:464 , G 0:475 , HOH 0:5118 , HOH 0:5157 , HOH 0:5159 , ARG C:55BINDING SITE FOR RESIDUE NA 88567
171SC9SOFTWAREG 0:798 , C 0:799 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 88568
172TC1SOFTWAREU 0:391 , U 0:392 , A 0:395 , U 0:398 , HOH 0:4983BINDING SITE FOR RESIDUE NA 88569
173TC2SOFTWAREG 0:1832 , A 0:2022 , HOH 0:7920 , HOH 0:7922 , HOH 0:8250BINDING SITE FOR RESIDUE NA 88570
174TC3SOFTWAREG 0:2491 , U 0:2492 , U 0:2528 , G 0:2529 , HOH 0:9174BINDING SITE FOR RESIDUE NA 88571
175TC4SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924BINDING SITE FOR RESIDUE NA 88572
176TC5SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:7480BINDING SITE FOR RESIDUE NA 88573
177TC6SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 88574
178TC7SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:6053BINDING SITE FOR RESIDUE NA 88575
179TC8SOFTWAREA 0:632 , C 0:633 , U 0:2535 , C 0:2536 , A 0:2538 , U 0:2539 , HOH 0:5435 , HOH 0:8451BINDING SITE FOR RESIDUE NA 88576
180TC9SOFTWAREG 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:6828BINDING SITE FOR RESIDUE NA 88577
181UC1SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:5477 , HIS L:18 , HOH L:4019 , HOH L:4020BINDING SITE FOR RESIDUE NA 88578
182UC2SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:5858 , HOH 0:5866BINDING SITE FOR RESIDUE NA 88579
183UC3SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:9309 , HOH 0:9310 , HOH 0:9315BINDING SITE FOR RESIDUE NA 88581
184UC4SOFTWAREG 0:2772 , G 0:2773 , HOH 0:9751BINDING SITE FOR RESIDUE NA 88582
185UC5SOFTWAREC 0:197 , HOH 0:4614 , HOH 0:4616BINDING SITE FOR RESIDUE NA 88584
186UC6SOFTWAREG 0:1077 , A 0:1079 , C 0:1080 , HOH 0:6467BINDING SITE FOR RESIDUE NA 88585
187UC7SOFTWAREG 0:1452 , G 0:1676BINDING SITE FOR RESIDUE CL 88803
188UC8SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 88805
189UC9SOFTWAREC 0:2388 , HOH 0:8822 , HIS Q:53 , PHE Q:56BINDING SITE FOR RESIDUE CL 88811
190VC1SOFTWAREG 0:2582 , A 0:2596 , LYS K:14 , ILE K:32 , SER K:33 , HOH K:4017BINDING SITE FOR RESIDUE CL 88812
191VC2SOFTWAREG 0:1300 , G 0:1329 , HOH 0:6844BINDING SITE FOR RESIDUE CL 88813
192VC3SOFTWAREG 0:644 , HIS L:13BINDING SITE FOR RESIDUE CL 88814
193VC4SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 88815
194VC5SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 88816
195VC6SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:4021BINDING SITE FOR RESIDUE CL 88817
196VC7SOFTWAREG 0:1072 , G 0:1087BINDING SITE FOR RESIDUE CL 88822
197VC8SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 18702
198VC9SOFTWAREGLY 3:45 , GLY 3:47 , ASP 3:49 , HOH 3:4031 , HOH 3:4032 , HOH 3:4034BINDING SITE FOR RESIDUE MG 38078
199WC1SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74 , HOH 3:4056BINDING SITE FOR RESIDUE CD 38704
200WC2SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 38804
201WC3SOFTWAREU 9:55 , A 9:56 , A 9:57 , HOH 9:4024BINDING SITE FOR RESIDUE MG 98095
202WC4SOFTWAREC 9:40 , LYS D:53BINDING SITE FOR RESIDUE NA 98551
203WC5SOFTWAREG 9:21 , U 9:55 , A 9:57BINDING SITE FOR RESIDUE NA 98583
204WC6SOFTWAREHOH 0:5760 , HOH 0:5761 , HOH A:4013 , HOH A:4017 , HOH A:4067 , HOH A:4069BINDING SITE FOR RESIDUE MG A8065
205WC7SOFTWAREA 0:2633 , PHE A:201 , GLY A:203 , HIS A:208 , HOH A:4087 , HOH A:4098BINDING SITE FOR RESIDUE NA A8545
206WC8SOFTWARELYS A:178BINDING SITE FOR RESIDUE CL A8809
207WC9SOFTWAREHOH 0:9615 , HOH 0:9618 , HOH 0:9620 , HOH B:4139 , HOH B:4142 , HOH B:4143BINDING SITE FOR RESIDUE MG B8055
208XC1SOFTWAREHOH 0:9388 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B8819
209XC2SOFTWAREASP C:45 , THR C:94 , LYS C:96BINDING SITE FOR RESIDUE NA C8504
210XC3SOFTWAREASP H:114 , ARG H:117BINDING SITE FOR RESIDUE NA H8522
211XC4SOFTWAREHOH 0:9556 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69 , HOH J:4019BINDING SITE FOR RESIDUE NA J8546
212XC5SOFTWAREILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J8801
213XC6SOFTWAREPRO J:88 , HIS J:89 , LYS J:90BINDING SITE FOR RESIDUE CL J8802
214XC7SOFTWAREGLY J:68 , TYR J:69 , HOH J:4019BINDING SITE FOR RESIDUE CL J8821
215XC8SOFTWAREHOH 0:7770 , HOH 0:9227 , HOH 0:9300 , ASN K:42 , HOH K:4028 , HOH K:4029BINDING SITE FOR RESIDUE MG K8069
216XC9SOFTWAREARG L:27 , GLY L:28 , GLY L:29 , GLY L:31 , ALA L:33 , GLU L:39BINDING SITE FOR RESIDUE NA L8580
217YC1SOFTWAREARG L:53 , GLN L:58BINDING SITE FOR RESIDUE CL L8810
218YC2SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:4078BINDING SITE FOR RESIDUE NA M8547
219YC3SOFTWARESER M:106 , ARG M:113 , VAL M:114 , ARG M:158 , VAL M:159BINDING SITE FOR RESIDUE CL M8818
220YC4SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N8807
221YC5SOFTWAREHIS O:40 , HOH O:4016 , HOH O:4019BINDING SITE FOR RESIDUE CD O8705
222YC6SOFTWAREASN O:44BINDING SITE FOR RESIDUE CL O8808
223YC7SOFTWAREASP Q:20 , ARG Q:21 , GLY Q:22 , THR Q:23 , SER Q:24 , SER Q:46 , HOH Q:4030BINDING SITE FOR RESIDUE NA Q8548
224YC8SOFTWAREHOH 0:9778 , NA 8:8538 , SER R:70 , VAL R:72 , HOH R:4040BINDING SITE FOR RESIDUE NA R8537
225YC9SOFTWAREC 0:2087 , GLN R:61 , ASN R:63BINDING SITE FOR RESIDUE NA R8586
226ZC1SOFTWARELYS R:118 , HOH R:4021BINDING SITE FOR RESIDUE CL R8806
227ZC2SOFTWAREHIS S:7 , GLU S:61 , HOH S:4028BINDING SITE FOR RESIDUE NA S8512
228ZC3SOFTWAREGLN T:37 , ARG T:111 , LEU T:112 , GLU T:113 , SER T:114 , ASP T:117 , HOH T:4015BINDING SITE FOR RESIDUE MG T8073
229ZC4SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U8701
230ZC5SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:4039 , HOH Y:4040 , HOH Y:4043BINDING SITE FOR RESIDUE MG Y8108
231ZC6SOFTWAREG 0:1269 , ARG Y:169BINDING SITE FOR RESIDUE CL Y8820
232ZC7SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z8703
233ZC8SOFTWAREC 0:839 , U 0:1838 , A 0:2099 , A 0:2100 , A 0:2103 , G 0:2540 , U 0:2620 , PSU 0:2621 , C 0:2644 , U 0:2645 , G 0:2646 , HOH 4:4001 , HOH 4:4002 , MG 7:8117BINDING SITE FOR CHAIN 4 OF QUINUPRISTIN

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YJW)

(-) Cis Peptide Bonds  (7, 7)

Asymmetric Unit
No.Residues
1Mhu 4:5 -Mhv 4:6
2Trp A:186 -Pro A:187
3Gly B:14 -Pro B:15
4Asn B:243 -Pro B:244
5Val C:136 -Pro C:137
6Gln F:55 -Pro F:56
7Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217
Biological Unit 1 (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1YJW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1yjw 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1yjw11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1yjw100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1yjw101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1yjw 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1yjw21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1yjw200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1yjw201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1yjw 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1yjw31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1yjw300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhh.....hhhhhh............eeeee.....eee.........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1yjw 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 4 from PDB  Type:PROTEIN  Length:8
                                         
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                1yjw 4    1 xTxPxxxx    8
                            | | ||||
                            1-MHW|||
                              3-DBB|
                                5-MHU
                                 6-MHV
                                  7-004
                                   8-MHT

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1yjw 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1yjwa2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1yjwa1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1yjwA01 A:1-78 Nucleic acid-binding proteins                                  ---1yjwA02 A:82-159  [code=2.30.30.30, no name defined]                          1yjwA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1yjwA02 A:10-82                                             -----Ribosomal_L2_C-1yjwA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhh.......hhhhh...............eeeeeeeeee....eeeeeeee....eeee..........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1yjwb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1yjwB01 B:1-38,B:207-257              1yjwB02 B:39-77,B:189-206,B:258-337    1yjwB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1yjwB02           1yjwB01 B:1-38,B:207-257                           1yjwB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1yjwB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee........................ee..eeeeeeee..eeeeeeee.......hhhhh.......hhhhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh................eehhhhhh.....hhhhhh.........................ee.................ee................eeeeeee............................eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1yjwc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1yjwC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1yjwC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhh..............................ee..ee.........................hhhhhhhhhhhhhhh..hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh.hhhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yjw C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1yjwd1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1yjwD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1yjwD0     1 D:11-64                     ---Ribosomal_L5_C-1yjwD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author hhhhhh.eeeeeeee.....-----..hhhhhhhhhh....ee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeeehhhhhhhhh.............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1yjwe1 E:1-79 Ribosomal protein L6                                            d1yjwe2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1yjwE01 E:1-79  [code=3.90.930.12, no name defined]                            1yjwE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1yjwE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1yjwE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee......eeeee..eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1yjwf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1yjwF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1yjwF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhh....eeee.....hhhhhhhhhhhhh....eeee.hhhhhhhhh.......eee......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1yjwg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1yjw G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1yjwh1 H:4-166 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1yjwH00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee....hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee...eeeeeeee...hhhhhhhhhhhhhhhh...eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1yjwi1 I:66-135 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1yjwI00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1yjwI01 I:66-134                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhhh.............eeehhhhhhhhhhhh.......hhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1yjw I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1yjwj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1yjwJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1yjwJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeee.hhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheeee.................hhhhh..eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1yjwk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1yjwK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1yjwK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee...............hhhhhh.hhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yjw K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1yjwl1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1yjwL01 L:1-50                                    1yjwL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1yjwL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhhh..............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eeehhhhh.......eeeee.........eeee.eehhhhhhhhhh...eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yjw L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1yjwm1 M:1-193 Ribosomal protein L15e                                                                                                                                                           - SCOP domains
               CATH domains 1yjwM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1yjwM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh...hhhhhhhhhhhhhhhhh...eee.....hhhhhhhh.......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1yjwn1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1yjwN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1yjwN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yjw N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1yjwo1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1yjwO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1yjwO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1yjwp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1yjwP01 P:1-55  [code=1.10.1650.10, no name defined]   1yjwP02 P:56-88 Single Heli x bin1yjwP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1yjwq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1yjwQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1yjwQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh...hhhhhh.......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1yjw Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1yjwr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1yjwR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1yjwR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeeee.hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhh...hhhhheeeeeeeeeeeee..eee.....eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yjw R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1yjws1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1yjwS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1yjwS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1yjw S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1yjwt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1yjwT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1yjwT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhh...eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1yjwu1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1yjwU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1yjwU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1yjw U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1yjwv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1yjwV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1yjwV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1yjw V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1yjww1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1yjwW01 W:1-57,W:114-154                                 1yjwW02 W:58-113  [code=1.10.15.30, no name defined]    1yjwW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1yjwW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhh...eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh.............ee.....................ee...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1yjwx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1yjwX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1yjwX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh..........eeeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1yjw X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1yjwy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1yjwY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee..hhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yjw Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1yjwz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1yjwZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1yjwZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh.ee......eeeeeee..eeee.....eee.......hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1yjw Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
01a1yjwD00D:10-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
02a1yjwF00F:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
03a1yjwS00S:1-81
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
04a1yjwN00N:1-186
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
05a1yjwW01W:1-57,W:114-154
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
06a1yjwB03B:78-188
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
07a1yjwM00M:1-194
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
08a1yjwC00C:1-246
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
09a1yjwH00H:4-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
10a1yjwE01E:1-79
10b1yjwE02E:80-172
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
11a1yjwJ00J:4-145
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
12a1yjwR00R:1-150
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
13a1yjwO00O:1-115
13b1yjwL02L:51-149
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
14a1yjw3003:1-92
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
15a1yjwX00X:7-88
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
16a1yjwL01L:1-50
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
17a1yjwA03A:160-237
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
18a1yjwB01B:1-38,B:207-257
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
19a1yjwW02W:58-113
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
20a1yjwP01P:1-55
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
21a1yjwI00I:66-135
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
22a1yjw2002:1-49
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
23a1yjwV00V:1-65
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
24a1yjwP03P:89-143
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
25a1yjwP02P:56-88
(-)
Class: Mainly Beta (13760)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
26a1yjwB02B:39-77,B:189-206,B:258-337
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
27a1yjwA01A:1-78
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
28a1yjwK00K:1-132
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
29a1yjwU00U:4-56
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
30a1yjwA02A:82-159
30b1yjwT00T:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
31a1yjwQ00Q:1-95
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
32a1yjw1001:1-56
32b1yjwZ00Z:10-82

(-) Pfam Domains  (26, 28)

Asymmetric Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    In