Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF CCDA-PHE-CAP-BIO AND THE ANTIBIOTIC SPARSOMYCIN BOUND TO THE LARGE RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  T. M. Schmeing, T. A. Steitz
Date :  16 Dec 04  (Deposition) - 29 Nov 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,9
Keywords :  Ribosome 50S, Protein-Protein Complex, Rna-Rna Complex, Protein-Rna Complex, Peptidyl Transferase Reaction, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. M. Schmeing, K. S. Huang, D. E. Kitchen, S. A. Strobel, T. A. Steitz
Structural Insights Into The Roles Of Water And The 2' Hydroxyl Of The P Site Trna In The Peptidyl Transferase Reaction.
Mol. Cell V. 20 437 2005
PubMed-ID: 16285925  |  Reference-DOI: 10.1016/J.MOLCEL.2005.09.006

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 3 - 5'-R(*CP*CP*(DA)*(PHE)*(ACA))-3'
    Chains4
    EngineeredYES
    Other DetailsCCDEOXYA-PHE-CAPROIC ACID BIOTIN OLIGOMER
    SyntheticYES
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L4E
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 32 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526272829303132
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ012349

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (13, 319)

Asymmetric/Biological Unit (13, 319)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2ACA1OTHER6-AMINOHEXANOIC ACID
3CD5Ligand/IonCADMIUM ION
4CL22Ligand/IonCHLORIDE ION
5K2Ligand/IonPOTASSIUM ION
6MG94Ligand/IonMAGNESIUM ION
7NA75Ligand/IonSODIUM ION
8OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
9OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
10PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
11SPS1Ligand/IonSPARSOMYCIN
12SR114Ligand/IonSTRONTIUM ION
13UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (311, 311)

Asymmetric Unit (311, 311)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2482 , A 0:2483 , A 0:2532 , C 0:2533 , C 0:2534 , HOH 0:4209 , HOH 0:8304 , HOH 0:9800BINDING SITE FOR RESIDUE MG 0 8001
002AC2SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , U 0:2535 , HOH 0:8282 , HOH 0:8283 , HOH 0:9881BINDING SITE FOR RESIDUE MG 0 8002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:4259 , HOH 0:9648 , HOH A:9522BINDING SITE FOR RESIDUE MG 0 8003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:3393 , HOH 0:4374 , HOH 0:8289 , HOH 0:9673BINDING SITE FOR RESIDUE MG 0 8004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4205 , HOH 0:8305 , HOH 0:8306BINDING SITE FOR RESIDUE MG 0 8005
006AC6SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:4222 , HOH 0:8298 , HOH 0:8379BINDING SITE FOR RESIDUE MG 0 8008
007AC7SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4330 , HOH 0:7897 , HOH 0:8299 , NA 0:9158 , HOH 0:9953BINDING SITE FOR RESIDUE MG 0 8009
008AC8SOFTWAREG 0:28 , U 0:1304 , HOH 0:3256 , HOH 0:3828 , HOH 0:4240 , HOH 0:8380 , HOH 0:9665BINDING SITE FOR RESIDUE MG 0 8012
009AC9SOFTWAREG 0:877 , G 0:2623 , A 0:2624 , HOH 0:4234 , HOH 0:8313 , HOH 0:8314BINDING SITE FOR RESIDUE MG 0 8013
010AD1SOFTWAREC 0:34 , U 0:457 , A 0:459 , HOH 0:4149 , HOH 0:4616 , HOH C:9153 , HOH C:9257BINDING SITE FOR RESIDUE SR 0 9500
011AD2SOFTWAREHOH 0:4095BINDING SITE FOR RESIDUE SR 0 9501
012AD3SOFTWAREA 0:1291 , HOH 0:5530 , HOH 0:8381BINDING SITE FOR RESIDUE SR 0 9504
013AD4SOFTWAREA 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752 , HOH 0:5502BINDING SITE FOR RESIDUE SR 0 9505
014AD5SOFTWAREA 0:632 , C 0:633 , A 0:2538 , U 0:2539 , HOH 0:4239 , HOH 0:5426 , HOH 0:8439BINDING SITE FOR RESIDUE SR 0 9506
015AD6SOFTWAREG 0:911 , G 0:1292 , HOH 0:3421 , HOH 0:3993 , HOH 0:4846BINDING SITE FOR RESIDUE SR 0 9508
016AD7SOFTWAREA 0:378 , G 0:379 , A 0:429 , HOH 0:5137 , HOH 0:7691 , HOH 0:7950BINDING SITE FOR RESIDUE SR 0 9509
017AD8SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 0 9515
018AD9SOFTWAREC 0:1103 , HOH 0:3165 , GLU J:28BINDING SITE FOR RESIDUE SR 0 9517
019BC1SOFTWAREG 0:2480 , G 0:2537 , HOH 0:3442 , HOH 0:4252 , HOH 0:4750 , HOH 0:8280 , HOH 0:9660BINDING SITE FOR RESIDUE MG 0 8014
020BC2SOFTWAREA 0:844 , A 0:1689 , HOH 0:4214 , HOH 0:8315 , HOH 0:9633 , HOH 0:9651BINDING SITE FOR RESIDUE MG 0 8015
021BC3SOFTWAREG 0:456 , HOH 0:3038 , HOH 0:4532 , HOH 0:8290 , GLY C:86 , HOH C:9162 , HOH C:9265BINDING SITE FOR RESIDUE MG 0 8017
022BC4SOFTWAREA 0:2011 , HOH 0:4737 , HOH 0:7715 , HOH 0:8309 , HOH 0:8310 , HOH 0:8311BINDING SITE FOR RESIDUE MG 0 8019
023BC5SOFTWAREC 0:1830 , HOH 0:8293 , HOH 0:8312 , HOH 0:9747 , HOH 0:9750 , HOH 0:9821BINDING SITE FOR RESIDUE MG 0 8020
024BC6SOFTWAREG 0:2304 , HOH 0:3574 , HOH 0:4230 , HOH 0:4231 , HOH 0:8296 , HOH 0:8297BINDING SITE FOR RESIDUE MG 0 8021
025BC7SOFTWAREG 0:2097 , G 0:2540 , HOH 0:4461 , HOH 0:5290 , HOH 0:9736BINDING SITE FOR RESIDUE MG 0 8022
026BC8SOFTWAREA 0:1381 , HOH 0:7168 , HOH 0:8382 , HIS X:23BINDING SITE FOR RESIDUE MG 0 8024
027BC9SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4755 , HOH 0:8318BINDING SITE FOR RESIDUE MG 0 8025
028BD1SOFTWAREG 0:2700BINDING SITE FOR RESIDUE SR 0 9522
029BD2SOFTWAREA 0:2622 , G 0:2623 , HOH 0:5207 , HOH 0:7690BINDING SITE FOR RESIDUE SR 0 9529
030BD3SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4314 , HOH 0:4478 , HOH 0:8317BINDING SITE FOR RESIDUE SR 0 9530
031BD4SOFTWAREA 0:1427 , HOH 0:5478 , HOH 0:8277BINDING SITE FOR RESIDUE SR 0 9532
032BD5SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3209 , HOH 0:4343 , HOH 0:4352BINDING SITE FOR RESIDUE SR 0 9534
033BD6SOFTWAREA 0:846 , G 0:1694 , G 0:1695 , PRO 1:6BINDING SITE FOR RESIDUE SR 0 9539
034BD7SOFTWAREG 0:2609 , U 0:2610 , HOH 0:3899 , HOH 0:4313 , HOH 0:6159 , HOH B:9647BINDING SITE FOR RESIDUE SR 0 9545
035BD8SOFTWAREA 0:1411 , U 0:1412 , HOH 0:6118 , HOH 0:7578BINDING SITE FOR RESIDUE SR 0 9547
036BD9SOFTWAREHOH 0:6276BINDING SITE FOR RESIDUE SR 0 9560
037CC1SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:3016 , HOH 0:8319 , HOH 0:8320BINDING SITE FOR RESIDUE MG 0 8026
038CC2SOFTWAREC 0:240 , G 0:269 , HOH 0:4463 , HOH 0:4604 , HOH 0:4742 , HOH 0:8385BINDING SITE FOR RESIDUE MG 0 8027
039CC3SOFTWAREA 0:1448 , U 0:1677 , HOH 0:4271 , HOH 0:4292 , HOH 0:4303 , HOH 0:8323BINDING SITE FOR RESIDUE MG 0 8028
040CC4SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:3817 , HOH 0:8325 , HOH 0:8327BINDING SITE FOR RESIDUE MG 0 8029
041CC5SOFTWAREU 0:1748 , U 0:1749 , HOH 0:4232 , HOH 0:8291 , HOH 0:8292 , HOH 0:8302BINDING SITE FOR RESIDUE MG 0 8030
042CC6SOFTWAREU 0:777 , C 0:778 , HOH 0:3876 , HOH 0:8329 , SR 0:9441 , HOH 1:9510BINDING SITE FOR RESIDUE MG 0 8031
043CC7SOFTWAREU 0:2115 , HOH 0:3600 , HOH 0:4774 , ALA A:196 , HOH A:9540 , HOH A:9614BINDING SITE FOR RESIDUE MG 0 8032
044CC8SOFTWAREG 0:956 , HOH 0:4263 , HOH 0:8333 , HOH 0:8334 , HOH 0:8335 , HOH 0:9988BINDING SITE FOR RESIDUE MG 0 8036
045CC9SOFTWAREA 0:2553 , HOH 0:3739 , HOH 0:3812 , HOH 0:4241 , HOH 0:8389 , HOH 0:9703BINDING SITE FOR RESIDUE MG 0 8037
046CD1SOFTWAREG 0:834 , U 0:835 , HOH 0:4498 , HOH 0:5041BINDING SITE FOR RESIDUE SR 0 9566
047CD2SOFTWAREU 0:2461 , HOH 0:6772 , ASP 3:59BINDING SITE FOR RESIDUE SR 0 9568
048CD3SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9570
049CD4SOFTWAREC 0:2591BINDING SITE FOR RESIDUE SR 0 9581
050CD5SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9585
051CD6SOFTWAREG 0:2102 , A 0:2103BINDING SITE FOR RESIDUE SR 0 9590
052CD7SOFTWAREOMG 0:2588 , G 0:2618 , HOH 0:5884BINDING SITE FOR RESIDUE SR 0 9601
053CD8SOFTWAREG 0:1376 , A 0:1693 , HOH 0:5052BINDING SITE FOR RESIDUE SR 0 9626
054CD9SOFTWAREU 0:1368 , HOH 0:5443 , HOH 0:6337 , HOH 0:6394 , HOH R:9465BINDING SITE FOR RESIDUE SR 0 9629
055DC1SOFTWAREHOH 0:4218 , HOH 0:4242 , HOH 0:4264 , HOH 0:4266 , HOH 0:8337 , HOH 0:9902BINDING SITE FOR RESIDUE MG 0 8038
056DC2SOFTWAREU 0:115 , HOH 0:3520 , HOH 0:4450 , HOH 0:4554 , HOH 0:5664 , HOH 0:6210 , HOH 0:8339BINDING SITE FOR RESIDUE MG 0 8039
057DC3SOFTWAREU 0:172 , U 0:392 , HOH 0:8391 , HOH 0:8392 , HOH M:9336BINDING SITE FOR RESIDUE MG 0 8040
058DC4SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:4694 , HOH 0:4785BINDING SITE FOR RESIDUE MG 0 8041
059DC5SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3060 , HOH 0:4250 , HOH 0:4990 , HOH 0:8340BINDING SITE FOR RESIDUE MG 0 8042
060DC6SOFTWAREG 0:816 , G 0:817 , HOH 0:3428 , HOH 0:7886 , MG 0:8106 , HOH 0:8393BINDING SITE FOR RESIDUE MG 0 8043
061DC7SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3895 , GLY R:65 , HOH R:9503BINDING SITE FOR RESIDUE MG 0 8044
062DC8SOFTWAREG 0:1979 , HOH 0:8341 , HOH 0:8394 , HOH 0:8395 , HOH 0:8396BINDING SITE FOR RESIDUE MG 0 8045
063DC9SOFTWAREG 0:1794 , HOH 0:7774 , HOH 0:8397 , HOH 0:8398BINDING SITE FOR RESIDUE MG 0 8046
064DD1SOFTWAREHOH 9:2984 , A 9:3056 , A 9:3057 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8095
065DD2SOFTWAREG 9:3021 , G 9:3022 , U 9:3055 , A 9:3057 , G 9:3058BINDING SITE FOR RESIDUE NA 9 9183
066DD3SOFTWAREHOH 0:5564 , C 9:3091 , HOH H:9526BINDING SITE FOR RESIDUE SR 9 9481
067DD4SOFTWAREG 9:3078 , G 9:3102BINDING SITE FOR RESIDUE SR 9 9503
068DD5SOFTWAREA 9:3044 , HOH 9:4351 , HOH 9:5767BINDING SITE FOR RESIDUE SR 9 9588
069DD6SOFTWAREA 0:2486 , U 0:2541 , UR3 0:2619 , U 0:2620 , A 0:2637 , C 4:75 , DA 4:76 , PHE 4:77 , ACA 4:78 , MG 4:8118BINDING SITE FOR RESIDUE SPS 4 9701
070DD7SOFTWAREA 0:2637 , HOH 0:8448 , HOH 0:8449 , C 4:75 , DA 4:76 , SPS 4:9701BINDING SITE FOR RESIDUE MG 4 8118
071DD8SOFTWAREG 0:1873 , HOH 0:4924 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120BINDING SITE FOR RESIDUE MG A 8066
072DD9SOFTWAREHOH 0:6913 , LYS A:178BINDING SITE FOR RESIDUE CL A 9309
073EC1SOFTWAREG 0:1099 , HOH 0:5065 , HOH 0:7553 , HOH 0:8410BINDING SITE FOR RESIDUE MG 0 8047
074EC2SOFTWAREC 0:2248BINDING SITE FOR RESIDUE MG 0 8050
075EC3SOFTWAREG 0:641 , A 0:1355 , HOH 0:4690 , HOH 0:8342 , HOH 0:8343BINDING SITE FOR RESIDUE MG 0 8051
076EC4SOFTWAREU 0:1125 , HOH 0:4216 , HOH 0:8412 , HOH 9:737 , G 9:3092BINDING SITE FOR RESIDUE MG 0 8052
077EC5SOFTWAREC 0:162 , U 0:2276 , HOH 0:3056 , HOH 0:8295 , HOH 0:8344 , HOH 0:8345BINDING SITE FOR RESIDUE MG 0 8054
078EC6SOFTWAREC 0:2720 , HOH 0:6936 , GLY B:337 , HOH B:9653 , HOH B:9654BINDING SITE FOR RESIDUE MG 0 8055
079EC7SOFTWAREA 0:2757 , HOH 0:4261 , HOH 0:4564 , HOH 0:8363 , ASN B:335 , HOH B:9543BINDING SITE FOR RESIDUE MG 0 8056
080EC8SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH A:9565 , HOH A:9616BINDING SITE FOR RESIDUE MG 0 8057
081EC9SOFTWAREG 0:1884 , HOH 0:3008 , HOH 0:3527 , HOH 0:4355 , HOH 0:8347BINDING SITE FOR RESIDUE MG 0 8058
082ED1SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9546 , HOH A:9585BINDING SITE FOR RESIDUE SR A 9436
083ED2SOFTWAREHOH 0:4924 , HOH 0:6478 , HOH 0:8427 , ASP A:26 , GLU A:28BINDING SITE FOR RESIDUE SR A 9437
084ED3SOFTWAREGLU A:28BINDING SITE FOR RESIDUE SR A 9497
085ED4SOFTWAREU 0:837 , HOH 0:5162 , HOH 0:7324 , GLN B:230BINDING SITE FOR RESIDUE NA B 9161
086ED5SOFTWAREHOH 0:3202 , ARG B:223 , LYS B:224BINDING SITE FOR RESIDUE CL B 9319
087ED6SOFTWAREHOH 0:3560 , HOH 0:3847 , ASN B:243 , SER B:245BINDING SITE FOR RESIDUE SR B 9458
088ED7SOFTWAREC 0:2672 , PRO B:24 , ARG B:25 , MET B:162 , ARG B:310BINDING SITE FOR RESIDUE SR B 9521
089ED8SOFTWAREASP C:45 , THR C:94 , LYS C:96 , HOH C:9110BINDING SITE FOR RESIDUE NA C 9104
090ED9SOFTWAREARG D:51 , PRO D:68BINDING SITE FOR RESIDUE NA D 9151
091FC1SOFTWAREG 0:2618 , HOH 0:4314 , HOH 0:4640 , HOH 0:9664 , HOH 0:9668BINDING SITE FOR RESIDUE MG 0 8059
092FC2SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:8350 , HOH 0:9794 , HOH M:9443BINDING SITE FOR RESIDUE MG 0 8060
093FC3SOFTWAREA 0:1369 , U 0:2650 , HOH 0:8351BINDING SITE FOR RESIDUE MG 0 8061
094FC4SOFTWAREG 0:1364 , HOH 0:4766 , HOH 0:5597 , HOH 0:7504 , HOH 0:8288 , HOH 0:8362BINDING SITE FOR RESIDUE MG 0 8063
095FC5SOFTWAREG 0:782 , C 0:783 , HOH A:9510 , HOH A:9586 , HOH A:9615BINDING SITE FOR RESIDUE MG 0 8065
096FC6SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8355 , ASN A:188BINDING SITE FOR RESIDUE MG 0 8067
097FC7SOFTWAREA 0:2569 , HOH 0:4342 , HOH 0:5392 , HOH 0:7180 , HOH 0:8414 , HOH E:920BINDING SITE FOR RESIDUE MG 0 8068
098FC8SOFTWAREA 0:166 , G 0:219 , HOH 0:4406 , HOH 0:5525 , HOH 0:6148 , HOH 0:9748BINDING SITE FOR RESIDUE MG 0 8070
099FC9SOFTWAREU 0:954 , C 0:2298 , HOH 0:4586 , HOH Q:7872BINDING SITE FOR RESIDUE MG 0 8072
100FD1SOFTWAREHOH 0:5668 , HOH F:6403BINDING SITE FOR RESIDUE SR F 9595
101FD2SOFTWAREA 0:1133 , G 0:1134 , TYR H:154 , ILE H:157 , THR H:158 , PRO H:159BINDING SITE FOR RESIDUE SR H 9486
102FD3SOFTWAREHOH 0:3105 , HOH 0:6308 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69BINDING SITE FOR RESIDUE NA J 9146
103FD4SOFTWAREHOH 0:4486 , ASN J:126 , ILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 9301
104FD5SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 9302
105FD6SOFTWAREHOH 0:6308 , GLY J:64 , ASN J:65 , GLY J:68 , TYR J:69BINDING SITE FOR RESIDUE CL J 9321
106FD7SOFTWAREHOH 0:4822 , HOH 0:6581 , HOH 0:8415 , ASN K:42 , HOH K:1797 , HOH K:2121BINDING SITE FOR RESIDUE MG K 8069
107FD8SOFTWAREARG L:53 , GLN L:58BINDING SITE FOR RESIDUE CL L 9310
108FD9SOFTWAREHOH 0:4248 , HOH 0:9899 , ARG L:27 , GLU L:39 , HOH L:9438 , HOH L:9496BINDING SITE FOR RESIDUE SR L 9409
109GC1SOFTWAREA 0:1286 , A 0:1287 , HOH 0:8356 , HOH 0:8357 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8074
110GC2SOFTWAREA 0:907 , A 0:908 , HOH 0:4229 , HOH 0:4506 , HOH 0:5504 , HOH 0:8358BINDING SITE FOR RESIDUE MG 0 8075
111GC3SOFTWAREHOH 0:7355 , HOH 0:8364 , HOH 0:8365 , HOH 0:8416 , HOH 0:8417 , HOH 2:7875BINDING SITE FOR RESIDUE MG 0 8076
112GC4SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:4204 , HOH 0:4210 , HOH 0:4221BINDING SITE FOR RESIDUE MG 0 8079
113GC5SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4789 , HOH 0:7188 , HOH 0:8368 , HOH 0:8419BINDING SITE FOR RESIDUE MG 0 8080
114GC6SOFTWAREC 0:1436 , A 0:1437 , HOH 0:5807 , HOH 0:8428BINDING SITE FOR RESIDUE MG 0 8082
115GC7SOFTWAREC 0:1753 , A 0:1754 , HOH 0:4300 , HOH 0:4738 , HOH 0:8369 , HOH 0:8420BINDING SITE FOR RESIDUE MG 0 8083
116GC8SOFTWAREA 0:1742 , G 0:2033 , HOH 0:3369 , HOH 0:4227 , HOH 0:8370BINDING SITE FOR RESIDUE MG 0 8084
117GC9SOFTWAREG 0:2617 , G 0:2618 , G 0:2642 , HOH 0:4379 , HOH 0:4932 , HOH 0:5056BINDING SITE FOR RESIDUE MG 0 8085
118GD1SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:9425BINDING SITE FOR RESIDUE NA M 9147
119GD2SOFTWARESER M:106 , ARG M:113 , VAL M:114 , VAL M:159BINDING SITE FOR RESIDUE CL M 9318
120GD3SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 9307
121GD4SOFTWAREHOH 0:6780 , HIS O:40BINDING SITE FOR RESIDUE CD O 9205
122GD5SOFTWAREHOH 0:7525 , ASN O:44BINDING SITE FOR RESIDUE CL O 9308
123GD6SOFTWAREASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427BINDING SITE FOR RESIDUE NA Q 9148
124GD7SOFTWAREHOH 0:4350 , SER R:70 , VAL R:72 , NA R:9138 , HOH R:9436 , HOH R:9469BINDING SITE FOR RESIDUE NA R 9137
125GD8SOFTWAREU 0:2659 , G 0:2660 , HOH 0:4350 , VAL R:72 , TRP R:75 , NA R:9137 , HOH R:9426BINDING SITE FOR RESIDUE NA R 9138
126GD9SOFTWARELYS R:118 , HOH R:9422BINDING SITE FOR RESIDUE CL R 9306
127HC1SOFTWAREG 0:2540 , G 0:2611 , HOH 0:4871 , NA 0:9139 , HOH 0:9690 , HOH 0:9916BINDING SITE FOR RESIDUE MG 0 8088
128HC2SOFTWAREA 0:516 , U 0:517 , G 0:518 , HOH 0:8373 , HOH 0:8421 , HOH 0:8422BINDING SITE FOR RESIDUE MG 0 8089
129HC3SOFTWAREA 0:2103 , HOH 0:4208 , HOH 0:4386BINDING SITE FOR RESIDUE MG 0 8090
130HC4SOFTWAREG 0:918 , HOH 0:3168 , HOH 0:3923 , HOH 0:7002 , HOH 0:8374 , HOH 0:9717BINDING SITE FOR RESIDUE MG 0 8091
131HC5SOFTWAREC 0:1844 , HOH 0:3008 , HOH 0:4237 , HOH 0:8423BINDING SITE FOR RESIDUE MG 0 8092
132HC6SOFTWAREA 0:1070 , G 0:1071 , HOH 0:3305 , HOH 0:4243 , HOH 0:4275 , HOH 0:4315BINDING SITE FOR RESIDUE MG 0 8093
133HC7SOFTWAREU 0:1096 , G 0:1258 , HOH 0:8375BINDING SITE FOR RESIDUE MG 0 8094
134HC8SOFTWAREG 0:1848 , G 0:1849 , HOH 0:4256 , HOH 0:4293 , HOH 0:4424 , HOH 0:4456BINDING SITE FOR RESIDUE MG 0 8096
135HC9SOFTWAREU 0:862 , G 0:863 , U 0:864 , HOH 0:3939 , HOH 0:4265 , HOH 0:6110BINDING SITE FOR RESIDUE MG 0 8097
136HD1SOFTWARENA 0:9186 , GLN R:61 , ASN R:63BINDING SITE FOR RESIDUE SR R 9418
137HD2SOFTWAREGLU S:61 , HOH S:9481BINDING SITE FOR RESIDUE NA S 9112
138HD3SOFTWAREHOH 0:5881 , ASP S:59BINDING SITE FOR RESIDUE SR S 9470
139HD4SOFTWARETYR T:35 , GLN T:37 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8073
140HD5SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 9201
141HD6SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:9362 , HOH Y:9384 , HOH Y:9415BINDING SITE FOR RESIDUE MG Y 8109
142HD7SOFTWAREHOH 0:4229 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 9320
143HD8SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 9203
144HD9SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 9202
145IC1SOFTWAREA 0:907 , HOH 0:3553 , HOH 0:3967 , HOH 0:4277 , HOH 0:4338 , HOH Y:9369BINDING SITE FOR RESIDUE MG 0 8098
146IC2SOFTWAREA 0:2612 , HOH 0:3623 , HOH 0:4260BINDING SITE FOR RESIDUE MG 0 8099
147IC3SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4337 , HOH 0:5194 , HOH 0:7411BINDING SITE FOR RESIDUE MG 0 8101
148IC4SOFTWAREA 0:2434 , U 0:2458 , HOH 0:9873 , HOH 3:9449 , HOH 3:9459 , HOH 3:9515BINDING SITE FOR RESIDUE MG 0 8102
149IC5SOFTWAREG 0:2578 , G 0:2579 , HOH 0:8425BINDING SITE FOR RESIDUE MG 0 8103
150IC6SOFTWAREC 0:2104 , C 0:2105 , HOH 0:8285 , HOH 0:8286BINDING SITE FOR RESIDUE MG 0 8104
151IC7SOFTWAREG 0:817 , HOH 0:4195 , HOH 0:7882 , HOH 0:7886 , MG 0:8043 , HOH 0:8393 , HOH P:184BINDING SITE FOR RESIDUE MG 0 8106
152IC8SOFTWAREC 0:1104 , A 0:1106 , A 0:1107 , HOH 0:8404 , HOH J:7851BINDING SITE FOR RESIDUE MG 0 8107
153IC9SOFTWAREHOH 0:7957 , HOH 0:8405 , HOH 0:8406 , HOH 0:8407BINDING SITE FOR RESIDUE MG 0 8108
154ID1SOFTWAREU 0:862 , HOH 0:5452 , HOH 0:9792 , LYS 1:10 , ASN 1:12 , HOH 1:9499BINDING SITE FOR RESIDUE SR 1 9419
155ID2SOFTWAREHOH 0:3392 , HOH 0:3830 , HOH 0:4472 , HOH 0:9920 , ASP 1:47 , HOH 1:9485BINDING SITE FOR RESIDUE SR 1 9460
156ID3SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74BINDING SITE FOR RESIDUE CD 3 9204
157ID4SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 9304
158ID5SOFTWAREHOH 0:8418 , GLY 3:45 , GLY 3:47 , ASP 3:49 , HOH 3:9462BINDING SITE FOR RESIDUE SR 3 9439
159JC1SOFTWAREU 0:903 , A 0:1357 , HOH 0:3129 , HOH 0:4515 , HOH 0:5964 , HOH 0:6570BINDING SITE FOR RESIDUE MG 0 8110
160JC2SOFTWAREA 0:187 , HOH 0:3190 , HOH 0:4318 , HOH 0:4359 , HOH 0:9754 , HOH 0:9950BINDING SITE FOR RESIDUE MG 0 8112
161JC3SOFTWAREA 0:2112 , HOH 0:3209 , HOH 0:4343 , HOH 0:4513 , HOH 0:6663 , HOH 0:6918BINDING SITE FOR RESIDUE MG 0 8113
162JC4SOFTWAREA 0:2430 , A 0:2468 , HOH 0:3073 , HOH 0:4553 , HOH 0:9969 , HOH 3:9474BINDING SITE FOR RESIDUE MG 0 8114
163JC5SOFTWAREHOH 0:4504 , HOH 0:4879 , HOH 0:7115 , HOH 0:7239 , MG 0:8116BINDING SITE FOR RESIDUE MG 0 8115
164JC6SOFTWAREU 0:1850 , HOH 0:4256 , HOH 0:4281 , HOH 0:4456 , HOH 0:4504 , HOH 0:7239 , MG 0:8115BINDING SITE FOR RESIDUE MG 0 8116
165JC7SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:5209 , HOH 0:9847BINDING SITE FOR RESIDUE MG 0 8117
166JC8SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 9001
167JC9SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:9642 , HOH 0:9737 , ARG M:82 , HOH M:9324BINDING SITE FOR RESIDUE K 0 9002
168KC1SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:5537BINDING SITE FOR RESIDUE NA 0 9101
169KC2SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:8318BINDING SITE FOR RESIDUE NA 0 9102
170KC3SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:4676 , HOH 0:5271 , HOH 0:6335BINDING SITE FOR RESIDUE NA 0 9105
171KC4SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9752BINDING SITE FOR RESIDUE NA 0 9106
172KC5SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 9107
173KC6SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4008 , SR 0:9473BINDING SITE FOR RESIDUE NA 0 9108
174KC7SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:5076BINDING SITE FOR RESIDUE NA 0 9110
175KC8SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:4172 , HOH 0:5226BINDING SITE FOR RESIDUE NA 0 9111
176KC9SOFTWAREG 0:2399 , HOH 0:3563 , HOH 0:4425 , HOH 0:5635 , HOH 0:5684BINDING SITE FOR RESIDUE NA 0 9113
177LC1SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3734 , HOH 0:9951BINDING SITE FOR RESIDUE NA 0 9114
178LC2SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:3308 , HOH 0:4204BINDING SITE FOR RESIDUE NA 0 9115
179LC3SOFTWAREC 0:896 , A 0:897 , HOH 0:6841 , HOH 0:9656BINDING SITE FOR RESIDUE NA 0 9116
180LC4SOFTWAREG 0:1416 , G 0:1417 , HOH 0:9896 , TRP 2:42 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 0 9117
181LC5SOFTWAREG 0:2544 , U 0:2545 , HOH 0:4519 , HOH 0:7968 , NA 0:9120BINDING SITE FOR RESIDUE NA 0 9118
182LC6SOFTWAREG 0:2543 , G 0:2544 , G 0:2611 , U 0:2615 , HOH 0:3360 , NA 0:9118 , HOH 0:9712BINDING SITE FOR RESIDUE NA 0 9120
183LC7SOFTWAREC 0:2287 , ARG H:114BINDING SITE FOR RESIDUE NA 0 9122
184LC8SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:5050BINDING SITE FOR RESIDUE NA 0 9123
185LC9SOFTWAREC 0:130 , U 0:146 , G 0:147 , HOH 0:3113 , HOH 0:7640BINDING SITE FOR RESIDUE NA 0 9124
186MC1SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3245 , HOH 0:3876 , HOH 0:8199 , SR 0:9441BINDING SITE FOR RESIDUE NA 0 9125
187MC2SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 0 9126
188MC3SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3347 , HOH 0:3806BINDING SITE FOR RESIDUE NA 0 9127
189MC4SOFTWAREG 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5778 , HOH 0:6998BINDING SITE FOR RESIDUE NA 0 9128
190MC5SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:7094BINDING SITE FOR RESIDUE NA 0 9129
191MC6SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9857BINDING SITE FOR RESIDUE NA 0 9130
192MC7SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:3172 , HOH 0:9919BINDING SITE FOR RESIDUE NA 0 9131
193MC8SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7566BINDING SITE FOR RESIDUE NA 0 9132
194MC9SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5813 , HOH 0:8436BINDING SITE FOR RESIDUE NA 0 9134
195NC1SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3485BINDING SITE FOR RESIDUE NA 0 9135
196NC2SOFTWAREG 0:1706 , G 0:1707 , HOH 0:3535 , HOH 0:5902 , HOH 0:7823 , HOH 0:8225BINDING SITE FOR RESIDUE NA 0 9136
197NC3SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , HOH 0:3635 , MG 0:8088BINDING SITE FOR RESIDUE NA 0 9139
198NC4SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3643 , HOH 0:6806 , HOH 0:7323BINDING SITE FOR RESIDUE NA 0 9140
199NC5SOFTWAREG 0:681 , G 0:683 , HOH 0:8429BINDING SITE FOR RESIDUE NA 0 9141
200NC6SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 0 9143
201NC7SOFTWAREA 0:914 , C 0:915 , C 0:1043 , G 0:1045 , HOH 0:6145BINDING SITE FOR RESIDUE NA 0 9149
202NC8SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:7462BINDING SITE FOR RESIDUE NA 0 9150
203NC9SOFTWAREA 0:955 , HOH 0:7118 , C 9:3081 , U 9:3082BINDING SITE FOR RESIDUE NA 0 9152
204OC1SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5389BINDING SITE FOR RESIDUE NA 0 9154
205OC2SOFTWAREG 0:1119 , C 0:1243 , HOH 0:5382 , THR J:47BINDING SITE FOR RESIDUE NA 0 9155
206OC3SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , A 0:2467 , HOH 0:3076BINDING SITE FOR RESIDUE NA 0 9156
207OC4SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:6805BINDING SITE FOR RESIDUE NA 0 9157
208OC5SOFTWAREG 0:2611 , HOH 0:3106 , MG 0:8009 , HOH 0:9953 , TRP B:242BINDING SITE FOR RESIDUE NA 0 9158
209OC6SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 9159
210OC7SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6498BINDING SITE FOR RESIDUE NA 0 9160
211OC8SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277BINDING SITE FOR RESIDUE NA 0 9162
212OC9SOFTWAREU 0:1359 , C 0:1360 , HOH 0:4073 , HOH 0:7541BINDING SITE FOR RESIDUE NA 0 9163
213PC1SOFTWAREU 0:2057 , G 0:2058 , HOH 0:3431BINDING SITE FOR RESIDUE NA 0 9164
214PC2SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , ALA M:194BINDING SITE FOR RESIDUE NA 0 9165
215PC3SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3498 , HOH 0:4411 , HOH 0:4471BINDING SITE FOR RESIDUE NA 0 9166
216PC4SOFTWAREG 0:464 , G 0:475 , HOH 0:3445 , HOH 0:5049 , HOH 0:5176 , ARG C:55BINDING SITE FOR RESIDUE NA 0 9167
217PC5SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 0 9168
218PC6SOFTWAREU 0:391 , U 0:392 , A 0:395 , HOH 0:7088 , HOH 0:7593 , SR 0:9461BINDING SITE FOR RESIDUE NA 0 9169
219PC7SOFTWAREU 0:1831 , C 0:2021 , HOH 0:4366 , HOH 0:9729BINDING SITE FOR RESIDUE NA 0 9170
220PC8SOFTWAREG 0:2491 , U 0:2492 , G 0:2529BINDING SITE FOR RESIDUE NA 0 9171
221PC9SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924 , HOH 0:9892BINDING SITE FOR RESIDUE NA 0 9172
222QC1SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:4273 , HOH 0:7778BINDING SITE FOR RESIDUE NA 0 9173
223QC2SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416 , HOH 0:3508BINDING SITE FOR RESIDUE NA 0 9174
224QC3SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9884BINDING SITE FOR RESIDUE NA 0 9175
225QC4SOFTWAREG 0:911 , U 0:1293 , G 0:1295 , HOH 0:6867BINDING SITE FOR RESIDUE NA 0 9177
226QC5SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3810 , HIS L:18 , HOH L:9429 , HOH L:9451BINDING SITE FOR RESIDUE NA 0 9178
227QC6SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:4306 , HOH 0:4997BINDING SITE FOR RESIDUE NA 0 9179
228QC7SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4283 , HOH 0:9949BINDING SITE FOR RESIDUE NA 0 9181
229QC8SOFTWAREG 0:2772 , G 0:2773 , HOH 0:4943BINDING SITE FOR RESIDUE NA 0 9182
230QC9SOFTWAREC 0:197 , HOH 0:5816BINDING SITE FOR RESIDUE NA 0 9184
231RC1SOFTWAREA 0:1079 , HOH 0:5758 , HOH 0:8219BINDING SITE FOR RESIDUE NA 0 9185
232RC2SOFTWAREU 0:12 , G 0:13 , LYS R:60 , GLN R:61 , SR R:9418BINDING SITE FOR RESIDUE NA 0 9186
233RC3SOFTWAREG 0:1676 , LYS 2:2BINDING SITE FOR RESIDUE CL 0 9303
234RC4SOFTWAREC 0:197 , G 0:201 , HOH 0:5475BINDING SITE FOR RESIDUE CL 0 9305
235RC5SOFTWAREC 0:2388 , HOH 0:3765 , PHE Q:52 , HIS Q:53BINDING SITE FOR RESIDUE CL 0 9311
236RC6SOFTWAREG 0:2582 , A 0:2596 , HOH 0:5661 , LYS K:14 , ILE K:32 , SER K:33BINDING SITE FOR RESIDUE CL 0 9312
237RC7SOFTWAREG 0:1299 , A 0:1328 , A 0:1329 , HOH 0:5231 , HOH 0:5519BINDING SITE FOR RESIDUE CL 0 9313
238RC8SOFTWAREG 0:644 , HIS L:13 , HOH L:9494BINDING SITE FOR RESIDUE CL 0 9314
239RC9SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 9315
240SC1SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 9316
241SC2SOFTWAREC 0:594 , U 0:595 , HOH Y:9356BINDING SITE FOR RESIDUE CL 0 9317
242SC3SOFTWAREG 0:1072 , G 0:1087 , A 0:1291 , HOH 0:5893BINDING SITE FOR RESIDUE CL 0 9322
243SC4SOFTWAREG 0:824 , G 0:854 , HOH 0:4547 , HOH 0:4869 , HOH 0:4993 , HOH 0:5101BINDING SITE FOR RESIDUE SR 0 9405
244SC5SOFTWAREG 0:836 , U 0:2615 , HOH 0:4430 , HOH 0:9982 , GLN B:230 , HOH B:9528BINDING SITE FOR RESIDUE SR 0 9406
245SC6SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3018 , HOH 0:4225 , HOH 0:4546 , HOH 0:6704BINDING SITE FOR RESIDUE SR 0 9407
246SC7SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:3955 , HOH 0:8294 , HOH 0:9635 , HOH 0:9726BINDING SITE FOR RESIDUE SR 0 9408
247SC8SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:3054 , HOH 0:7096 , HOH 0:8438BINDING SITE FOR RESIDUE SR 0 9410
248SC9SOFTWAREA 0:1754 , A 0:1755 , HOH 0:7104 , HOH 0:7652 , HOH 0:8134BINDING SITE FOR RESIDUE SR 0 9411
249TC1SOFTWAREC 0:893 , HOH 0:6183 , HOH 0:8437 , HOH C:9148BINDING SITE FOR RESIDUE SR 0 9412
250TC2SOFTWAREG 0:1055 , HOH 0:4417 , HOH 0:5398 , HOH 0:6857 , ASP H:10 , HOH H:9507BINDING SITE FOR RESIDUE SR 0 9413
251TC3SOFTWAREU 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:9441BINDING SITE FOR RESIDUE SR 0 9414
252TC4SOFTWAREHOH 0:4358 , HOH 0:6065 , HOH 0:6685 , HOH 0:7108 , HOH 0:7395 , HOH 0:8376 , HOH 0:8377BINDING SITE FOR RESIDUE SR 0 9415
253TC5SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3296BINDING SITE FOR RESIDUE SR 0 9416
254TC6SOFTWAREC 0:85 , A 0:86 , C 0:87 , HOH 0:5917 , ASP T:68BINDING SITE FOR RESIDUE SR 0 9417
255TC7SOFTWAREHOH 0:4736 , HOH 0:5448 , HOH 0:5783BINDING SITE FOR RESIDUE SR 0 9420
256TC8SOFTWAREU 0:664 , G 0:681 , HOH 0:7433 , HOH C:9141BINDING SITE FOR RESIDUE SR 0 9421
257TC9SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4685 , HOH 0:6002 , HOH 0:6321BINDING SITE FOR RESIDUE SR 0 9422
258UC1SOFTWAREU 0:454 , C 0:478 , HOH 0:4802 , HOH 0:6201BINDING SITE FOR RESIDUE SR 0 9423
259UC2SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:8307 , HOH 0:8308 , HOH 0:8327BINDING SITE FOR RESIDUE SR 0 9424
260UC3SOFTWAREG 0:2543 , C 0:2608BINDING SITE FOR RESIDUE SR 0 9425
261UC4SOFTWAREG 0:2632 , HOH 0:3897 , HOH 0:5115 , HOH 0:6041BINDING SITE FOR RESIDUE SR 0 9426
262UC5SOFTWAREA 0:1717 , G 0:1718 , HOH 0:5125 , HOH 0:5906 , HOH 0:6904BINDING SITE FOR RESIDUE SR 0 9427
263UC6SOFTWAREG 0:471 , HOH 0:3647 , HOH 0:4969 , HOH 0:6172 , HOH 0:7974 , HOH 0:9828 , HOH 0:9864BINDING SITE FOR RESIDUE SR 0 9428
264UC7SOFTWAREG 0:1059 , C 0:1127 , HOH 0:4413 , HOH 0:5438 , HOH 0:5879 , HOH 0:9741 , HOH 0:9992BINDING SITE FOR RESIDUE SR 0 9429
265UC8SOFTWAREA 0:639 , G 0:640 , HOH 0:3249 , HOH 0:3513 , HOH 0:4575 , HOH 0:5390 , HOH 0:5831 , HOH 0:6587BINDING SITE FOR RESIDUE SR 0 9430
266UC9SOFTWAREG 0:2725 , G 0:2755 , HOH 0:3870 , HOH 0:4404 , HOH 0:6865 , HOH 0:7182BINDING SITE FOR RESIDUE SR 0 9431
267VC1SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 9432
268VC2SOFTWAREHOH 0:3940 , HOH 0:6331 , HOH 0:6968BINDING SITE FOR RESIDUE SR 0 9433
269VC3SOFTWAREA 0:2553 , HOH 0:3208 , HOH 0:3739 , HOH 0:4241BINDING SITE FOR RESIDUE SR 0 9434
270VC4SOFTWAREU 0:1109 , G 0:1110 , A 0:1247 , HOH 0:4049 , HOH 0:7471BINDING SITE FOR RESIDUE SR 0 9435
271VC5SOFTWAREG 0:1543 , HOH 0:5553 , HOH 0:6619 , HOH 0:6630BINDING SITE FOR RESIDUE SR 0 9438
272VC6SOFTWAREA 0:532 , U 0:533 , HOH 0:4324 , HOH 0:4565 , HOH 0:8371 , HOH 0:8372BINDING SITE FOR RESIDUE SR 0 9440
273VC7SOFTWAREU 0:777 , U 0:864 , HOH 0:3245 , HOH 0:3876 , HOH 0:4265 , HOH 0:4269 , HOH 0:7940 , MG 0:8031 , NA 0:9125BINDING SITE FOR RESIDUE SR 0 9441
274VC8SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8400 , HOH 0:8401BINDING SITE FOR RESIDUE SR 0 9442
275VC9SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3821 , HOH 0:4207 , HOH 0:7930 , HOH 0:8381BINDING SITE FOR RESIDUE SR 0 9443
276WC1SOFTWAREC 0:880 , A 0:882 , U 0:883 , HOH 0:4215 , HOH 0:8366 , HOH 0:8367 , HOH 0:9863BINDING SITE FOR RESIDUE SR 0 9444
277WC2SOFTWAREHOH 0:4872 , HOH 0:7019 , HOH 0:7998BINDING SITE FOR RESIDUE SR 0 9445
278WC3SOFTWAREHOH 0:5584 , HOH 0:5745 , HOH 0:6672BINDING SITE FOR RESIDUE SR 0 9446
279WC4SOFTWAREG 0:84 , C 0:85 , HOH 0:5917 , ASP T:68 , HOH T:4745BINDING SITE FOR RESIDUE SR 0 9447
280WC5SOFTWAREA 0:2465 , G 0:2466 , HOH 0:4841 , HOH 0:8435 , HOH 0:9687 , ASP L:36BINDING SITE FOR RESIDUE SR 0 9448
281WC6SOFTWAREG 0:1683 , U 0:1696 , HOH 0:3401 , HOH 0:5329 , HOH 0:5409BINDING SITE FOR RESIDUE SR 0 9449
282WC7SOFTWAREA 0:2746 , G 0:2750 , HOH 0:6423 , HOH 0:6793 , HOH 0:8433BINDING SITE FOR RESIDUE SR 0 9450
283WC8SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6654 , HOH 0:7856BINDING SITE FOR RESIDUE SR 0 9451
284WC9SOFTWAREU 0:2016 , HOH 0:7859 , HOH 0:8105BINDING SITE FOR RESIDUE SR 0 9452
285XC1SOFTWAREG 0:1484 , HOH 0:4308 , HOH 0:8332 , HOH 0:8387 , HOH 0:8388BINDING SITE FOR RESIDUE SR 0 9453
286XC2SOFTWAREG 0:2091 , HOH 0:3692 , HOH 0:6639 , HOH 0:7190BINDING SITE FOR RESIDUE SR 0 9454
287XC3SOFTWAREC 0:1690 , HOH 0:3069 , HOH 0:4334 , HOH 0:4637 , HOH 0:5277 , HOH 0:7420BINDING SITE FOR RESIDUE SR 0 9455
288XC4SOFTWAREA 0:2302 , A 0:2303 , HOH 0:4235 , HOH 0:4361 , HOH 0:5435BINDING SITE FOR RESIDUE SR 0 9456
289XC5SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , HOH 0:3423 , HOH 0:4211 , HOH 0:4344BINDING SITE FOR RESIDUE SR 0 9457
290XC6SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 9459
291XC7SOFTWAREU 0:391 , HOH 0:3633 , HOH 0:6001 , NA 0:9169 , ARG 3:42BINDING SITE FOR RESIDUE SR 0 9461
292XC8SOFTWAREG 0:2810 , HOH 0:4634 , HOH 0:8143 , ASN B:27BINDING SITE FOR RESIDUE SR 0 9462
293XC9SOFTWAREU 0:2557 , HOH 0:3664 , HOH 0:7174BINDING SITE FOR RESIDUE SR 0 9464
294YC1SOFTWAREA 0:682 , G 0:683 , HOH 0:8429 , HOH 0:8440BINDING SITE FOR RESIDUE SR 0 9465
295YC2SOFTWAREC 0:1462 , A 0:1463 , HOH 0:6741 , GLY 1:40BINDING SITE FOR RESIDUE SR 0 9466
296YC3SOFTWAREA 0:1133 , G 0:1134 , HOH 0:3050 , HOH 0:4944 , HOH 0:5364BINDING SITE FOR RESIDUE SR 0 9467
297YC4SOFTWAREU 0:1972 , HOH 0:3289 , HOH 0:3902BINDING SITE FOR RESIDUE SR 0 9468
298YC5SOFTWAREG 0:1113 , HOH 0:4287 , HOH 0:4297BINDING SITE FOR RESIDUE SR 0 9469
299YC6SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4036 , HOH 0:4186 , NA 0:9108BINDING SITE FOR RESIDUE SR 0 9473
300YC7SOFTWAREG 0:2284 , HOH 0:6075 , HOH 0:7687 , HOH 0:8246 , HOH 0:8457BINDING SITE FOR RESIDUE SR 0 9474
301YC8SOFTWAREG 0:2777 , HOH 0:4782 , HOH 0:7834BINDING SITE FOR RESIDUE SR 0 9475
302YC9SOFTWAREA 0:1815 , HOH 0:7890 , HOH 0:8360 , HOH 0:8361BINDING SITE FOR RESIDUE SR 0 9477
303ZC1SOFTWAREC 0:235 , HOH 0:5272 , HOH 0:6012 , HOH 0:6686 , HOH 0:8077BINDING SITE FOR RESIDUE SR 0 9478
304ZC2SOFTWAREU 0:2690 , HOH 0:3659 , HOH 0:6093BINDING SITE FOR RESIDUE SR 0 9480
305ZC3SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5444 , GLY L:14 , HOH L:9495BINDING SITE FOR RESIDUE SR 0 9482
306ZC4SOFTWAREA 0:565 , G 0:592BINDING SITE FOR RESIDUE SR 0 9483
307ZC5SOFTWAREHOH 0:6972 , HOH 0:7779 , HOH 0:7924BINDING SITE FOR RESIDUE SR 0 9488
308ZC6SOFTWAREU 0:1835 , HOH 0:3587BINDING SITE FOR RESIDUE SR 0 9489
309ZC7SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE SR 0 9490
310ZC8SOFTWAREHOH 0:5121 , HOH 0:6076 , HOH 0:7704BINDING SITE FOR RESIDUE SR 0 9495
311ZC9SOFTWAREC 0:1129 , HOH 0:4216 , HOH 0:6634 , HOH 0:8412 , C 9:3091 , G 9:3092 , HOH 9:3843BINDING SITE FOR RESIDUE SR 0 9498

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VQ8)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:111-127
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:126-140
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1VQ8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1vq8 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1vq811 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1vq8100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1vq8101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1vq8 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1vq821 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1vq8200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1vq8201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1vq8 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1vq831 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1vq8300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1vq8 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 4 from PDB  Type:DNA/OTHER/PROTEIN/RNA  Length:5
                                      
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                1vq8 4   74 CCAFx   78
                                |
                               78-ACA

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1vq8 9 3001 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC 3122
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100      3110      3120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1vq8a2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1vq8a1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1vq8A01 A:1-78 Nucleic acid-binding proteins                                  ---1vq8A02 A:82-159  [code=2.30.30.30, no name defined]                          1vq8A03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1vq8A02 A:10-82                                             -----Ribosomal_L2_C-1vq8A01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeee..........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee..............hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1vq8b1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1vq8B01 B:1-38,B:207-257              1vq8B02 B:39-77,B:189-206,B:258-337    1vq8B03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1vq8B02           1vq8B01 B:1-38,B:207-257                           1vq8B02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1vq8B01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.ee..........eeeeeee.....eehhhhhhh....hhhhhh.........................ee....eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1vq8c1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1vq8C00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1vq8C01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee..............eeee....hhhhhhhhhh....eeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vq8 C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1vq8d1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1vq8D00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1vq8D0     1 D:11-64                     ---Ribosomal_L5_C-1vq8D02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhh....eeee..............eeeeeeee.hhhhhhhhhhhhhhh..hhhhh.....eee.--------------------.eeeeeeehhhhhhhh........hhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1vq8e1 E:1-79 Ribosomal protein L6                                            d1vq8e2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1vq8E01 E:1-79  [code=3.90.930.12, no name defined]                            1vq8E02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1vq8E01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1vq8E02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeeee..eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1vq8f1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1vq8F00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1vq8F01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhh....eeee....hhhhh.hhhhhhhh....eeee.hhhhhhhhh.......eeee.....hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1vq8g1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1vq8 G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1vq8h1 H:1-163 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1vq8H00 H:1-171  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh......................................eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhhhhh...eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 H    1 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA  171
                                    10        20        30        40        50        60        70        80        90        |-         -|      120       130       140       150       160       170 
                                                                                                                             99         111                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1vq8i1 I:71-140 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1vq8I00 I:71-140  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1vq8I01 I:71-139                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhh...............eeeehhhhhhhhhhh.......hhhhhhhhhhhhh....eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1vq8 I   71 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  140
                                    80        90       100       110       120       130       140

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1vq8j1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1vq8J00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1vq8J01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1vq8k1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1vq8K00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1vq8K01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vq8 K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1vq8l1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1vq8L01 L:1-50                                    1vq8L02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1vq8L01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author .hhhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhhhhhhh......-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vq8 L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1vq8m1 M:1-194 Ribosomal protein L15e                                                                                                                                                             SCOP domains
               CATH domains 1vq8M00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1vq8M01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeeee..eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1vq8n1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1vq8N00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1vq8N01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vq8 N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1vq8o1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1vq8O00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1vq8O01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1vq8p1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1vq8P01 P:1-55  [code=1.10.1650.10, no name defined]   1vq8P02 P:56-88 Single Heli x bin1vq8P03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1vq8q1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1vq8Q00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1vq8Q01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhhh......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1vq8 Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1vq8r1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1vq8R00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1vq8R01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vq8 R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1vq8s1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1vq8S00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1vq8S01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1vq8 S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1vq8t1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1vq8T00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1vq8T01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1vq8u1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1vq8U00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1vq8U01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1vq8 U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1vq8v1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1vq8V00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1vq8V01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1vq8 V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1vq8w1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1vq8W01 W:1-57,W:114-154                                 1vq8W02 W:58-113  [code=1.10.15.30, no name defined]    1vq8W01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1vq8W01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhh...eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh....hhhhh....ee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1vq8x1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1vq8X00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1vq8X01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhh.........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1vq8 X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1vq8y1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1vq8Y01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh.......hhhhh............................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vq8 Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1vq8z1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1vq8Z00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1vq8Z01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh.ee......eeeeeee..eeee.....eee.......hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1vq8 Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric/Biological Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SPS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    HD9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    ID1  [ RasMol ]  +environment [ RasMol ]
    ID2  [ RasMol ]  +environment [ RasMol ]
    ID3  [ RasMol ]  +environment [ RasMol ]
    ID4  [ RasMol ]  +environment [ RasMol ]
    ID5  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vq8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P606171ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P158251jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P141221c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P291981ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P224501c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P606181ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P127371ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P127331ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P141231ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P141191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P127341ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P109701ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P127321ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P141161ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P109721ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P109711ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P202761c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P141211ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P181381ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P127361ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P606191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P324101ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P224521ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P202791ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P324111ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P127351ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P141241ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P141351c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P127431ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

1ffk 1ffz 1fgo 1jj2 1kqs 1m90 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp