Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CO-CRYSTAL STRUCTURE OF MYCALAMIDE A BOUND TO THE LARGE RIBOSOMAL SUBUNIT
 
Authors :  G. Gurel, G. Blaha, T. A. Steitz, P. B. Moore
Date :  03 Jul 09  (Deposition) - 09 Mar 10  (Release) - 09 Mar 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.11
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,9
Keywords :  Large Ribosomal Subunit, Mycalamide A, Ribonucleoprotein, Ribosomal Protein, Rna-Binding, Rrna-Binding, Trna-Binding, Metal-Binding, Zinc, Zinc-Finger, Acetylation, Ribosome- Antibiotic Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Gurel, G. Blaha, T. A. Steitz, P. B. Moore
Structures Of Triacetyloleandomycin And Mycalamide A Bind To The Large Ribosomal Subunit Of Haloarcula Marismortui.
Antimicrob. Agents Chemother. V. 53 5010 2009
PubMed-ID: 19738021  |  Reference-DOI: 10.1128/AAC.00817-09

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    Organism ScientificHALOARCULA MARISMORTUI ATCC 43049
    Organism Taxid272569
 
Molecule 2 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL2, HL4
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL3, HL1
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L4P
    ChainsC
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL4, HL6
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL5, HL13
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL6, HL10
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHS6
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L10E
    ChainsG
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymRIBOSOMAL PROTEIN L10, ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG, L10E, HMAL10
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL11
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL13
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL14, HL27
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL15, HL9
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    Synonym50S RIBOSOMAL PROTEIN LC12
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL18, HL12
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL29, L19
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL19, HL24
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL31
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL22, HL23
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL23, HL25, L21
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL24, HL16, HL15
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL21/HL22
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL29, HL33
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL30, HL20, HL16
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL34, HL30
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL5
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL35E
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL39E, HL46E
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymLA, HLA
 
Molecule 31 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 32 - DNA/RNA (5'-R(*CP*CP*(5AA)P*(2OP)P*(PO2) P*AP*CP*C)-3')
    Chains4
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526272829303132
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ012349

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (15, 314)

Asymmetric/Biological Unit (15, 314)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
22OP1Mod. Nucleotide(2S)-2-HYDROXYPROPANOIC ACID
35AA1Mod. NucleotideN6-DIMETHYL-3'-AMINO-ADENOSINE-5'-MONOPHOSPHATE
4CD5Ligand/IonCADMIUM ION
5CL22Ligand/IonCHLORIDE ION
6K2Ligand/IonPOTASSIUM ION
7MG93Ligand/IonMAGNESIUM ION
8MYL1Ligand/IonMYCALAMIDE A
9NA75Ligand/IonSODIUM ION
10OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
11OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
12PO21Mod. NucleotideHYPOPHOSPHITE
13PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
14SR108Ligand/IonSTRONTIUM ION
15UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (303, 303)

Asymmetric Unit (303, 303)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:3480 , HOH 0:7743 , HOH 0:8175BINDING SITE FOR RESIDUE MG 0 8001
002AC2SOFTWAREU 0:626 , G 0:627 , A 0:2483 , C 0:2534 , HOH 0:2977 , HOH 0:7721 , HOH 0:7722BINDING SITE FOR RESIDUE MG 0 8002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:5772 , HOH 0:8223 , HOH A:241BINDING SITE FOR RESIDUE MG 0 8003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:3062 , HOH 0:5618 , HOH 0:7728 , HOH 0:8344BINDING SITE FOR RESIDUE MG 0 8004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:7744 , HOH 0:7745 , HOH 0:8170BINDING SITE FOR RESIDUE MG 0 8005
006AC6SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:4792 , HOH 0:7737 , HOH 0:7827 , HOH 0:8188BINDING SITE FOR RESIDUE MG 0 8006
007AC7SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:7286 , HOH 0:7738 , HOH 0:7739 , HOH 0:8299 , NA 0:8549BINDING SITE FOR RESIDUE MG 0 8007
008AC8SOFTWAREG 0:28 , U 0:1304 , HOH 0:3034 , HOH 0:5106 , HOH 0:7146 , HOH 0:7828 , HOH 0:8207BINDING SITE FOR RESIDUE MG 0 8008
009AC9SOFTWAREG 0:877 , G 0:2623 , HOH 0:2986 , HOH 0:5772 , HOH 0:8201 , HOH 0:8214 , HOH A:7752BINDING SITE FOR RESIDUE MG 0 8009
010AD1SOFTWAREA 0:1427BINDING SITE FOR RESIDUE SR 0 8991
011AD2SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , MG 0:8089BINDING SITE FOR RESIDUE SR 0 8992
012AD3SOFTWAREHOH 0:8146BINDING SITE FOR RESIDUE SR 0 8993
013AD4SOFTWAREG 0:1694 , G 0:1695 , HOH 0:5319BINDING SITE FOR RESIDUE SR 0 8994
014AD5SOFTWAREG 0:2609 , HOH 0:4740BINDING SITE FOR RESIDUE SR 0 8995
015AD6SOFTWAREA 0:1411BINDING SITE FOR RESIDUE SR 0 8996
016AD7SOFTWAREG 0:834 , U 0:835 , G 0:2643BINDING SITE FOR RESIDUE SR 0 8998
017AD8SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9000
018AD9SOFTWAREHOH 0:6678BINDING SITE FOR RESIDUE SR 0 9001
019BC1SOFTWAREG 0:2102 , G 0:2537 , HOH 0:3013 , HOH 0:8217 , HOH 0:8792BINDING SITE FOR RESIDUE MG 0 8010
020BC2SOFTWAREA 0:844 , A 0:882 , A 0:1689 , HOH 0:2991 , HOH 0:7754 , HOH 0:8180 , HOH 1:57BINDING SITE FOR RESIDUE MG 0 8011
021BC3SOFTWAREG 0:456 , G 0:458 , HOH 0:4350 , HOH 0:7729 , HOH C:2051 , HOH C:2465 , HOH C:7228BINDING SITE FOR RESIDUE MG 0 8012
022BC4SOFTWAREA 0:1941 , A 0:2011 , HOH 0:7014 , HOH 0:7748 , HOH 0:7749 , HOH 0:7750 , HOH 0:8779BINDING SITE FOR RESIDUE MG 0 8013
023BC5SOFTWAREC 0:1830 , G 0:1832 , HOH 0:3302 , HOH 0:3312 , HOH 0:3547 , HOH 0:7732 , HOH 0:7751BINDING SITE FOR RESIDUE MG 0 8014
024BC6SOFTWAREG 0:2304 , HOH 0:6226 , HOH 0:7735 , HOH 0:7736 , HOH 0:8198BINDING SITE FOR RESIDUE MG 0 8015
025BC7SOFTWAREG 0:2097 , G 0:2540 , HOH 0:3272 , HOH 0:3920 , HOH 0:4531 , HOH 0:7740 , HOH 0:8436BINDING SITE FOR RESIDUE MG 0 8016
026BC8SOFTWAREA 0:1381 , HOH 0:4092 , HOH 0:6161 , HOH 0:7830 , HOH 0:7831BINDING SITE FOR RESIDUE MG 0 8017
027BC9SOFTWAREU 0:1120 , G 0:1121 , HOH 0:7758 , HOH 0:7759 , HOH 0:7832 , HOH 0:8797BINDING SITE FOR RESIDUE MG 0 8018
028BD1SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9002
029BD2SOFTWAREG 0:2102 , A 0:2103BINDING SITE FOR RESIDUE SR 0 9004
030BD3SOFTWAREG 0:2639 , HOH 0:4355BINDING SITE FOR RESIDUE SR 0 9006
031BD4SOFTWAREG 0:1376 , A 0:1693BINDING SITE FOR RESIDUE SR 0 9007
032BD5SOFTWAREU 0:1368 , HOH 0:7427BINDING SITE FOR RESIDUE SR 0 9008
033BD6SOFTWAREC 0:2431 , C 0:2432 , A 0:2433 , G 0:2459 , A 0:2460 , HOH 0:3635 , HOH 0:3672 , HOH 0:5669 , HOH 0:6899 , HOH 0:7370 , HOH 0:8226 , GLN 3:30 , LYS 3:51 , LYS 3:54 , GLY 3:57BINDING SITE FOR RESIDUE MYL 0 2924
034BD7SOFTWAREHOH 0:6136 , HOH 0:8599 , THR A:184 , HOH A:396 , HOH A:2191 , HOH A:5306 , HOH A:7810BINDING SITE FOR RESIDUE MG A 8050
035BD8SOFTWAREG 0:1873 , HOH 0:3019 , ASP A:26 , LEU A:27 , ARG A:120BINDING SITE FOR RESIDUE MG A 8051
036BD9SOFTWAREHOH 0:5843 , LYS A:178BINDING SITE FOR RESIDUE CL A 8809
037CC1SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:4261 , HOH 0:7760 , HOH 0:7761 , HOH 0:7762BINDING SITE FOR RESIDUE MG 0 8019
038CC2SOFTWAREC 0:240 , U 0:268 , G 0:269 , HOH 0:7833 , HOH 0:8439 , HOH 0:8644 , HOH 0:8784BINDING SITE FOR RESIDUE MG 0 8020
039CC3SOFTWAREA 0:1448 , U 0:1677 , HOH 0:7764 , HOH 0:8235 , HOH 0:8257 , HOH 0:8268BINDING SITE FOR RESIDUE MG 0 8021
040CC4SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:7765 , HOH 0:7766 , HOH 0:7767 , HOH 0:7768BINDING SITE FOR RESIDUE MG 0 8022
041CC5SOFTWAREU 0:1748 , U 0:1749 , HOH 0:5256 , HOH 0:7730 , HOH 0:7731 , HOH 0:7741 , HOH 0:8199BINDING SITE FOR RESIDUE MG 0 8023
042CC6SOFTWAREU 0:777 , C 0:778 , HOH 0:3761 , HOH 0:7771 , SR 0:8934 , HOH 1:7770BINDING SITE FOR RESIDUE MG 0 8024
043CC7SOFTWAREU 0:2115 , G 0:2272 , HOH 0:6314 , HOH 0:8350 , HOH 0:8828 , HOH A:1083 , HOH A:2172BINDING SITE FOR RESIDUE MG 0 8025
044CC8SOFTWAREG 0:956 , HOH 0:4183 , HOH 0:7777 , HOH 0:7778 , HOH 0:7779 , HOH 0:8227BINDING SITE FOR RESIDUE MG 0 8026
045CC9SOFTWAREA 0:2553 , C 0:2575 , HOH 0:3146 , HOH 0:6798 , HOH 0:7084 , HOH 0:7837 , HOH 0:8208BINDING SITE FOR RESIDUE MG 0 8027
046CD1SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208BINDING SITE FOR RESIDUE SR A 8929
047CD2SOFTWAREHOH 0:3019 , GLU A:28BINDING SITE FOR RESIDUE SR A 8930
048CD3SOFTWAREHOH 0:5879 , HOH 0:7675 , HOH 0:8356 , GLY B:337 , HOH B:7867 , HOH U:2221BINDING SITE FOR RESIDUE MG B 8042
049CD4SOFTWAREU 0:837 , HOH 0:3356 , HOH 0:4060 , GLN B:230 , GLY B:231BINDING SITE FOR RESIDUE NA B 8552
050CD5SOFTWAREHOH 0:4920 , HOH 0:5151 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 8819
051CD6SOFTWAREASN B:243 , SER B:245BINDING SITE FOR RESIDUE SR B 8950
052CD7SOFTWAREC 0:2672 , ARG B:25 , PHE B:26 , ARG B:310BINDING SITE FOR RESIDUE SR B 8987
053CD8SOFTWAREASP C:45 , THR C:94 , LYS C:96 , HOH C:251BINDING SITE FOR RESIDUE NA C 8503
054CD9SOFTWAREHOH 0:4068 , HOH F:985BINDING SITE FOR RESIDUE SR F 9005
055DC1SOFTWAREG 0:2271 , A 0:2274 , HOH 0:3851 , HOH 0:6694 , HOH 0:7781 , HOH 0:8184 , HOH 0:8209 , HOH 0:8228BINDING SITE FOR RESIDUE MG 0 8028
056DC2SOFTWAREU 0:115 , HOH 0:6072 , HOH 0:7783 , HOH 0:8595BINDING SITE FOR RESIDUE MG 0 8029
057DC3SOFTWAREU 0:172 , U 0:392 , HOH 0:3429 , HOH 0:5311 , HOH 0:5555 , HOH 0:7839 , HOH 0:7840 , HOH 0:8351BINDING SITE FOR RESIDUE MG 0 8030
058DC4SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:6485 , HOH 0:8839 , HOH M:4431BINDING SITE FOR RESIDUE MG 0 8031
059DC5SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3118 , HOH 0:4428 , HOH 0:7784 , HOH 0:8216BINDING SITE FOR RESIDUE MG 0 8032
060DC6SOFTWAREG 0:816 , G 0:817 , HOH 0:5747 , HOH 0:7265BINDING SITE FOR RESIDUE MG 0 8033
061DC7SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:7354 , GLY R:65 , HOH R:7785BINDING SITE FOR RESIDUE MG 0 8034
062DC8SOFTWAREG 0:1979 , HOH 0:7786 , HOH 0:7842 , HOH 0:7843 , HOH 0:7844BINDING SITE FOR RESIDUE MG 0 8035
063DC9SOFTWAREG 0:1794 , HOH 0:7097 , HOH 0:7845 , HOH 0:7846BINDING SITE FOR RESIDUE MG 0 8036
064DD1SOFTWAREARG H:117BINDING SITE FOR RESIDUE NA H 8518
065DD2SOFTWAREA 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , THR H:161 , PRO H:162BINDING SITE FOR RESIDUE SR H 8972
066DD3SOFTWAREA 0:2677 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69 , HOH J:603 , HOH J:4949BINDING SITE FOR RESIDUE NA J 8538
067DD4SOFTWAREASN J:126 , ILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 8801
068DD5SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 8802
069DD6SOFTWAREGLY J:64 , ASN J:65 , TYR J:69BINDING SITE FOR RESIDUE CL J 8821
070DD7SOFTWAREHOH 0:5362 , HOH 0:8877 , ASN K:42 , HOH K:1797 , HOH K:2121 , HOH K:3492 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8054
071DD8SOFTWAREARG L:53 , GLN L:58BINDING SITE FOR RESIDUE CL L 8810
072DD9SOFTWAREA 0:1296 , GLY L:14 , ARG L:21BINDING SITE FOR RESIDUE SR L 8969
073EC1SOFTWAREA 0:1098 , G 0:1099 , HOH 0:5677 , HOH 0:6780 , HOH 0:7864BINDING SITE FOR RESIDUE MG 0 8037
074EC2SOFTWAREC 0:2248 , HOH 0:7128BINDING SITE FOR RESIDUE MG 0 8038
075EC3SOFTWAREG 0:641 , A 0:1355 , HOH 0:7787 , HOH 0:7788 , HOH 0:8732BINDING SITE FOR RESIDUE MG 0 8039
076EC4SOFTWAREC 0:162 , U 0:163 , U 0:2276 , HOH 0:3108 , HOH 0:4403 , HOH 0:7789BINDING SITE FOR RESIDUE MG 0 8041
077EC5SOFTWAREC 0:2720 , A 0:2757 , HOH 0:7811 , HOH 0:8225 , ASN B:335 , HOH B:1254 , HOH B:2508BINDING SITE FOR RESIDUE MG 0 8043
078EC6SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:3941 , MG 0:8045 , GLN A:207 , HOH A:7868BINDING SITE FOR RESIDUE MG 0 8044
079EC7SOFTWAREG 0:2013 , HOH 0:7793 , HOH 0:7794 , MG 0:8044 , HOH 0:8326 , HOH A:7792 , HOH A:7868BINDING SITE FOR RESIDUE MG 0 8045
080EC8SOFTWAREG 0:2618 , HOH 0:3033 , HOH 0:3043 , HOH 0:7742 , HOH 0:8681BINDING SITE FOR RESIDUE MG 0 8046
081EC9SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:5311 , HOH 0:7796 , HOH 0:7797BINDING SITE FOR RESIDUE MG 0 8047
082ED1SOFTWARESER M:106 , PHE M:109 , PRO M:110 , ASN M:111 , LEU M:112 , HOH M:6250BINDING SITE FOR RESIDUE NA M 8539
083ED2SOFTWARESER M:106 , VAL M:114 , VAL M:159 , HOH M:6250BINDING SITE FOR RESIDUE CL M 8818
084ED3SOFTWAREARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 8807
085ED4SOFTWAREHIS O:40 , HOH O:5322 , HOH O:5650BINDING SITE FOR RESIDUE CD O 8705
086ED5SOFTWAREG 0:745 , ASN O:44BINDING SITE FOR RESIDUE CL O 8808
087ED6SOFTWAREASP Q:20 , ARG Q:21 , GLY Q:22 , THR Q:23 , SER Q:24 , SER Q:46 , HOH Q:1795BINDING SITE FOR RESIDUE NA Q 8540
088ED7SOFTWAREHOH 0:5181 , HOH 0:8308 , HOH 0:8320 , SER R:70 , VAL R:72 , ASP R:73 , NA R:8533BINDING SITE FOR RESIDUE NA R 8532
089ED8SOFTWAREU 0:2659 , G 0:2660 , HOH 0:8320 , VAL R:72 , TRP R:75 , HOH R:1316 , NA R:8532BINDING SITE FOR RESIDUE NA R 8533
090ED9SOFTWAREU 0:12 , LYS R:60 , ASN R:63 , SR R:8912BINDING SITE FOR RESIDUE NA R 8575
091FC1SOFTWAREA 0:1369 , U 0:2650 , HOH 0:5759 , HOH 0:7798 , HOH 0:7799 , HOH 0:7800BINDING SITE FOR RESIDUE MG 0 8048
092FC2SOFTWAREHOH 0:6712 , HOH 0:7297 , HOH 0:7727 , HOH 0:7809 , HOH 0:8818 , HOH C:7869BINDING SITE FOR RESIDUE MG 0 8049
093FC3SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:7802 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8052
094FC4SOFTWAREA 0:2568 , A 0:2569 , HOH 0:3676 , HOH 0:5460 , HOH 0:5607 , HOH 0:6236 , HOH 0:7870 , HOH 0:8312BINDING SITE FOR RESIDUE MG 0 8053
095FC5SOFTWAREA 0:166 , G 0:219 , HOH 0:3303 , HOH 0:4431BINDING SITE FOR RESIDUE MG 0 8055
096FC6SOFTWAREU 0:954 , C 0:2298 , HOH 0:7264 , HOH 0:7658 , HOH 0:7806 , HOH 0:8626 , HOH Q:7872BINDING SITE FOR RESIDUE MG 0 8056
097FC7SOFTWAREA 0:1286 , A 0:1287 , HOH 0:7803 , HOH 0:7804 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8058
098FC8SOFTWAREA 0:907 , A 0:908 , HOH 0:3832 , HOH 0:7805 , HOH 0:8196 , HOH 0:8484BINDING SITE FOR RESIDUE MG 0 8059
099FC9SOFTWAREG 0:164 , A 0:165 , A 0:167 , C 0:168 , HOH 0:8169 , HOH 0:8176 , HOH 0:8187 , NA 0:8513BINDING SITE FOR RESIDUE MG 0 8061
100FD1SOFTWAREHOH R:423BINDING SITE FOR RESIDUE CL R 8806
101FD2SOFTWAREGLN R:61 , ASN R:63 , NA R:8575BINDING SITE FOR RESIDUE SR R 8912
102FD3SOFTWAREHIS S:7 , GLU S:61BINDING SITE FOR RESIDUE NA S 8510
103FD4SOFTWAREHOH 0:4349 , ASP S:59BINDING SITE FOR RESIDUE SR S 8961
104FD5SOFTWAREGLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8057
105FD6SOFTWARECYS U:6 , TYR U:8 , PHE U:31 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 8701
106FD7SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:3892 , HOH Y:5308 , HOH Y:7863BINDING SITE FOR RESIDUE MG Y 8086
107FD8SOFTWAREHOH 0:3832 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 8820
108FD9SOFTWAREASN Z:65 , CYS Z:66 , CYS Z:81 , CYS Z:84BINDING SITE FOR RESIDUE CD Z 8703
109GC1SOFTWAREA 0:1684 , A 0:1691 , C 0:1692 , U 0:1724 , HOH 0:3225 , HOH 0:6254 , HOH 0:7816 , HOH 0:7880BINDING SITE FOR RESIDUE MG 0 8062
110GC2SOFTWAREA 0:1437 , HOH 0:4137 , HOH 0:4252 , HOH 0:7889 , HOH 0:7890BINDING SITE FOR RESIDUE MG 0 8063
111GC3SOFTWAREC 0:1753 , A 0:1754 , HOH 0:5792 , HOH 0:7817 , HOH 0:7881 , HOH 0:8264 , HOH 0:8780BINDING SITE FOR RESIDUE MG 0 8064
112GC4SOFTWAREA 0:1742 , G 0:1743 , G 0:1744 , G 0:1745 , HOH 0:3726 , HOH 0:4199 , HOH 0:5528 , HOH 0:7818 , HOH 0:8193BINDING SITE FOR RESIDUE MG 0 8065
113GC5SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3028 , HOH 0:3033 , HOH 0:3214 , HOH 0:4989 , HOH 0:6269BINDING SITE FOR RESIDUE MG 0 8066
114GC6SOFTWAREG 0:2540 , G 0:2611 , HOH 0:2939 , HOH 0:3104 , HOH 0:3899 , HOH 0:6503 , NA 0:8534BINDING SITE FOR RESIDUE MG 0 8067
115GC7SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:7821 , HOH 0:7882 , HOH 0:7883BINDING SITE FOR RESIDUE MG 0 8068
116GC8SOFTWAREU 0:2478 , HOH 0:4632 , HOH 0:5142 , HOH 0:8174BINDING SITE FOR RESIDUE MG 0 8069
117GC9SOFTWAREG 0:918 , HOH 0:3194 , HOH 0:5968 , HOH 0:7822BINDING SITE FOR RESIDUE MG 0 8070
118GD1SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 8702
119GD2SOFTWAREHOH 0:3219 , ASP 1:47 , HOH 1:980BINDING SITE FOR RESIDUE SR 1 8952
120GD3SOFTWAREHOH 0:6489 , HOH 0:7812 , HOH 0:7813 , HOH 0:7877 , HOH 2:7875BINDING SITE FOR RESIDUE MG 2 8060
121GD4SOFTWAREHOH 0:4490 , HOH 0:6899 , LYS 3:54 , HOH 3:1812BINDING SITE FOR RESIDUE MG 3 8090
122GD5SOFTWARECYS 3:11BINDING SITE FOR RESIDUE CD 3 8704
123GD6SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 8804
124GD7SOFTWAREGLY 3:45BINDING SITE FOR RESIDUE SR 3 8932
125GD8SOFTWAREPRO 3:61BINDING SITE FOR RESIDUE SR 3 8999
126GD9SOFTWAREU 0:1125 , HOH 0:8182 , G 9:90 , G 9:92 , HOH 9:737 , HOH 9:2357BINDING SITE FOR RESIDUE MG 9 8040
127HC1SOFTWAREA 0:1843 , C 0:1844 , HOH 0:4245 , HOH 0:7884 , HOH 0:8204 , HOH 0:8218BINDING SITE FOR RESIDUE MG 0 8071
128HC2SOFTWAREG 0:627 , A 0:1070 , G 0:1071 , HOH 0:5283 , HOH 0:8210 , HOH 0:8239 , HOH 0:8281BINDING SITE FOR RESIDUE MG 0 8072
129HC3SOFTWAREU 0:1096 , C 0:1257 , G 0:1258 , HOH 0:7885BINDING SITE FOR RESIDUE MG 0 8073
130HC4SOFTWAREG 0:1848 , G 0:1849 , HOH 0:8221 , HOH 0:8258 , HOH 0:8396 , HOH 0:8431BINDING SITE FOR RESIDUE MG 0 8075
131HC5SOFTWAREG 0:863 , U 0:864 , HOH 0:4669 , HOH 0:7499 , HOH 0:8229 , HOH 0:8233BINDING SITE FOR RESIDUE MG 0 8076
132HC6SOFTWAREA 0:907 , HOH 0:6177 , HOH 0:7575 , HOH 0:8241 , HOH 0:8307 , LYS Y:145 , HOH Y:4368BINDING SITE FOR RESIDUE MG 0 8077
133HC7SOFTWAREA 0:2612 , U 0:2648 , HOH 0:6399 , HOH 0:8224 , HOH 0:8236BINDING SITE FOR RESIDUE MG 0 8078
134HC8SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:3402BINDING SITE FOR RESIDUE MG 0 8079
135HC9SOFTWAREA 0:2434 , U 0:2458 , HOH 0:3741 , SER 3:27BINDING SITE FOR RESIDUE MG 0 8080
136HD1SOFTWAREG 9:21 , A 9:56 , A 9:57 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8074
137HD2SOFTWAREC 9:40BINDING SITE FOR RESIDUE NA 9 8543
138HD3SOFTWAREG 9:21 , G 9:22 , U 9:55 , A 9:57 , G 9:58 , HOH 9:7361BINDING SITE FOR RESIDUE NA 9 8572
139HD4SOFTWAREC 0:1129 , HOH 0:5437 , HOH 0:8182 , C 9:91 , G 9:92BINDING SITE FOR RESIDUE SR 9 8978
140HD5SOFTWAREG 9:78 , G 9:102BINDING SITE FOR RESIDUE SR 9 8980
141HD6SOFTWAREA 9:44 , HOH 9:4351BINDING SITE FOR RESIDUE SR 9 9003
142IC1SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:7886BINDING SITE FOR RESIDUE MG 0 8081
143IC2SOFTWAREC 0:2104 , C 0:2105 , HOH 0:7726BINDING SITE FOR RESIDUE MG 0 8082
144IC3SOFTWAREG 0:817 , HOH 0:7265 , HOH 0:7841 , HOH 0:8158 , HOH P:5319BINDING SITE FOR RESIDUE MG 0 8083
145IC4SOFTWAREC 0:1103 , C 0:1105 , A 0:1106 , A 0:1107 , HOH 0:7850 , HOH 0:7851 , HOH 0:7852 , HOH 0:7853BINDING SITE FOR RESIDUE MG 0 8084
146IC5SOFTWAREHOH 0:5433 , HOH 0:7369 , HOH 0:7858 , HOH 0:7859 , HOH 0:7860BINDING SITE FOR RESIDUE MG 0 8085
147IC6SOFTWAREU 0:903 , A 0:1357 , HOH 0:4458 , HOH 0:4681 , HOH 0:5344 , HOH 0:8494BINDING SITE FOR RESIDUE MG 0 8087
148IC7SOFTWAREA 0:187 , HOH 0:3326 , HOH 0:4039 , HOH 0:4886 , HOH 0:8285 , HOH 0:8330BINDING SITE FOR RESIDUE MG 0 8088
149IC8SOFTWAREA 0:2112 , HOH 0:3770 , HOH 0:4953 , HOH 0:5474 , HOH 0:5848 , HOH 0:8313 , SR 0:8992BINDING SITE FOR RESIDUE MG 0 8089
150IC9SOFTWAREHOH 0:2928 , HOH 0:2950 , HOH 0:5843 , HOH 0:6129 , HOH 0:7887 , MG 0:8092 , HOH 0:8482BINDING SITE FOR RESIDUE MG 0 8091
151JC1SOFTWAREU 0:1850 , HOH 0:6329 , MG 0:8091 , HOH 0:8246 , HOH 0:8431 , HOH 0:8482BINDING SITE FOR RESIDUE MG 0 8092
152JC2SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:3418 , HOH 0:3639 , HOH 0:6075BINDING SITE FOR RESIDUE MG 0 8093
153JC3SOFTWAREG 0:2102 , G 0:2482 , U 0:2539BINDING SITE FOR RESIDUE K 0 8401
154JC4SOFTWAREC 0:162 , U 0:172 , ARG M:82BINDING SITE FOR RESIDUE K 0 8402
155JC5SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3877 , HOH 0:6913 , HOH 0:7057BINDING SITE FOR RESIDUE NA 0 8501
156JC6SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122BINDING SITE FOR RESIDUE NA 0 8502
157JC7SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:3514 , HOH 0:8718BINDING SITE FOR RESIDUE NA 0 8504
158JC8SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649BINDING SITE FOR RESIDUE NA 0 8505
159JC9SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 8506
160KC1SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:7854BINDING SITE FOR RESIDUE NA 0 8507
161KC2SOFTWAREA 0:2577 , G 0:2578 , G 0:2579BINDING SITE FOR RESIDUE NA 0 8508
162KC3SOFTWAREG 0:2524 , G 0:2525 , HOH 0:3502BINDING SITE FOR RESIDUE NA 0 8509
163KC4SOFTWAREA 0:2398 , G 0:2399 , HOH 0:4019 , HOH 0:4089 , HOH 0:6201 , HOH 0:8397BINDING SITE FOR RESIDUE NA 0 8511
164KC5SOFTWAREU 0:2541 , U 0:2607 , HOH 0:4041 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8512
165KC6SOFTWAREA 0:165 , A 0:166 , A 0:167 , MG 0:8061BINDING SITE FOR RESIDUE NA 0 8513
166KC7SOFTWAREC 0:896 , A 0:897 , HOH 0:3005 , HOH 0:5294 , HOH 0:5736BINDING SITE FOR RESIDUE NA 0 8514
167KC8SOFTWAREG 0:1416 , G 0:1417 , HOH 0:3839 , TRP 2:42 , ARG 2:43 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 0 8515
168KC9SOFTWAREG 0:2543 , G 0:2544 , HOH 0:7937 , HOH 0:8497 , NA 0:8517BINDING SITE FOR RESIDUE NA 0 8516
169LC1SOFTWAREG 0:2543 , U 0:2615 , HOH 0:5499 , NA 0:8516BINDING SITE FOR RESIDUE NA 0 8517
170LC2SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:3208BINDING SITE FOR RESIDUE NA 0 8519
171LC3SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147BINDING SITE FOR RESIDUE NA 0 8520
172LC4SOFTWAREA 0:776 , U 0:779 , A 0:780 , G 0:865 , HOH 0:5069 , HOH 0:7287 , SR 0:8934BINDING SITE FOR RESIDUE NA 0 8521
173LC5SOFTWAREC 0:1946 , G 0:1971 , U 0:2012BINDING SITE FOR RESIDUE NA 0 8522
174LC6SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , G 0:1832 , HOH 0:3032 , HOH 0:5440 , HOH 0:7070BINDING SITE FOR RESIDUE NA 0 8523
175LC7SOFTWAREG 0:56 , A 0:59 , G 0:61 , C 0:62BINDING SITE FOR RESIDUE NA 0 8524
176LC8SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:6098BINDING SITE FOR RESIDUE NA 0 8525
177LC9SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:3690BINDING SITE FOR RESIDUE NA 0 8526
178MC1SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221BINDING SITE FOR RESIDUE NA 0 8527
179MC2SOFTWAREG 0:386 , U 0:402BINDING SITE FOR RESIDUE NA 0 8528
180MC3SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:4260BINDING SITE FOR RESIDUE NA 0 8529
181MC4SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:5929BINDING SITE FOR RESIDUE NA 0 8530
182MC5SOFTWAREG 0:1706 , G 0:1707 , HOH 0:4383 , HOH 0:6130 , HOH 0:7172 , HOH 0:7645BINDING SITE FOR RESIDUE NA 0 8531
183MC6SOFTWAREG 0:2540 , U 0:2645 , MG 0:8067BINDING SITE FOR RESIDUE NA 0 8534
184MC7SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:6445BINDING SITE FOR RESIDUE NA 0 8535
185MC8SOFTWAREG 0:681 , G 0:683BINDING SITE FOR RESIDUE NA 0 8536
186MC9SOFTWAREU 0:308 , G 0:334 , U 0:335 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 0 8537
187NC1SOFTWAREA 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045BINDING SITE FOR RESIDUE NA 0 8541
188NC2SOFTWAREU 0:623 , U 0:624 , C 0:633 , G 0:901 , HOH 0:6642BINDING SITE FOR RESIDUE NA 0 8542
189NC3SOFTWAREA 0:955 , HOH 0:4269 , C 9:81 , U 9:82BINDING SITE FOR RESIDUE NA 0 8544
190NC4SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112BINDING SITE FOR RESIDUE NA 0 8545
191NC5SOFTWAREG 0:1119 , C 0:1243 , THR J:47 , HOH J:3661BINDING SITE FOR RESIDUE NA 0 8546
192NC6SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463BINDING SITE FOR RESIDUE NA 0 8547
193NC7SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:5681 , HOH 0:8629BINDING SITE FOR RESIDUE NA 0 8548
194NC8SOFTWAREG 0:2611 , HOH 0:4610 , HOH 0:7755 , MG 0:8007 , HOH 0:8436 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8549
195NC9SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 8550
196OC1SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5232 , HOH 0:8540BINDING SITE FOR RESIDUE NA 0 8551
197OC2SOFTWAREG 0:2111 , U 0:2277 , HOH 0:4339BINDING SITE FOR RESIDUE NA 0 8553
198OC3SOFTWAREC 0:1360 , HOH 0:5043 , HOH 0:5331BINDING SITE FOR RESIDUE NA 0 8554
199OC4SOFTWAREG 0:636 , U 0:2057 , G 0:2058 , HOH 0:4963 , HOH 0:5752BINDING SITE FOR RESIDUE NA 0 8555
200OC5SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 0 8556
201OC6SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:8446BINDING SITE FOR RESIDUE NA 0 8557
202OC7SOFTWAREG 0:464 , G 0:475 , HOH 0:3207 , ARG C:55BINDING SITE FOR RESIDUE NA 0 8558
203OC8SOFTWAREG 0:798 , G 0:814 , U 0:815 , HOH 0:8450BINDING SITE FOR RESIDUE NA 0 8559
204OC9SOFTWAREA 0:395 , U 0:398 , HOH 0:3113 , SR 0:8953BINDING SITE FOR RESIDUE NA 0 8560
205PC1SOFTWAREG 0:1832 , A 0:2022 , HOH 0:3241 , HOH 0:8731BINDING SITE FOR RESIDUE NA 0 8561
206PC2SOFTWAREU 0:2492 , U 0:2528 , G 0:2529BINDING SITE FOR RESIDUE NA 0 8562
207PC3SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924BINDING SITE FOR RESIDUE NA 0 8563
208PC4SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , HOH 0:7101BINDING SITE FOR RESIDUE NA 0 8564
209PC5SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 0 8565
210PC6SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887BINDING SITE FOR RESIDUE NA 0 8566
211PC7SOFTWAREG 0:911 , U 0:1293 , A 0:1294 , G 0:1295BINDING SITE FOR RESIDUE NA 0 8567
212PC8SOFTWAREC 0:762 , G 0:902 , U 0:903 , HIS L:18 , ARG L:21 , HOH L:1534 , HOH L:2203BINDING SITE FOR RESIDUE NA 0 8568
213PC9SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:3128 , HOH 0:8271BINDING SITE FOR RESIDUE NA 0 8569
214QC1SOFTWAREU 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4038 , HOH 0:5450 , HOH 0:6803 , HOH 0:8248BINDING SITE FOR RESIDUE NA 0 8570
215QC2SOFTWAREG 0:2772 , G 0:2773BINDING SITE FOR RESIDUE NA 0 8571
216QC3SOFTWAREC 0:197 , ASP L:102BINDING SITE FOR RESIDUE NA 0 8573
217QC4SOFTWAREG 0:1077 , A 0:1079 , HOH 0:7635BINDING SITE FOR RESIDUE NA 0 8574
218QC5SOFTWAREG 0:1452 , G 0:1676BINDING SITE FOR RESIDUE CL 0 8803
219QC6SOFTWAREG 0:201BINDING SITE FOR RESIDUE CL 0 8805
220QC7SOFTWAREC 0:2388 , HOH 0:6893 , HIS Q:53 , PHE Q:56BINDING SITE FOR RESIDUE CL 0 8811
221QC8SOFTWAREG 0:2582 , A 0:2596 , HOH 0:4058 , LYS K:14 , ILE K:32 , SER K:33BINDING SITE FOR RESIDUE CL 0 8812
222QC9SOFTWAREA 0:1328 , G 0:1329 , HOH 0:3448 , HOH 0:3850BINDING SITE FOR RESIDUE CL 0 8813
223RC1SOFTWAREG 0:644 , HIS L:13BINDING SITE FOR RESIDUE CL 0 8814
224RC2SOFTWAREA 0:1597 , A 0:1598 , G 0:1646 , G 0:1647BINDING SITE FOR RESIDUE CL 0 8815
225RC3SOFTWAREG 0:1119 , LYS J:56BINDING SITE FOR RESIDUE CL 0 8816
226RC4SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:6413BINDING SITE FOR RESIDUE CL 0 8817
227RC5SOFTWAREG 0:1072 , G 0:1087BINDING SITE FOR RESIDUE CL 0 8822
228RC6SOFTWAREG 0:824 , G 0:854 , HOH 0:2936 , HOH 0:3123 , HOH 0:3276 , HOH 0:8589BINDING SITE FOR RESIDUE SR 0 8901
229RC7SOFTWAREG 0:836 , U 0:2615 , HOH 0:4152 , GLN B:230 , HOH B:343BINDING SITE FOR RESIDUE SR 0 8902
230RC8SOFTWAREG 0:1489 , G 0:1491 , HOH 0:4273 , HOH 0:5539 , HOH 0:8587BINDING SITE FOR RESIDUE SR 0 8903
231RC9SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:4394BINDING SITE FOR RESIDUE SR 0 8904
232SC1SOFTWAREA 0:1755 , HOH 0:6927BINDING SITE FOR RESIDUE SR 0 8905
233SC2SOFTWAREC 0:893 , HOH 0:5674 , HOH 0:7378BINDING SITE FOR RESIDUE SR 0 8906
234SC3SOFTWAREG 0:1055 , HOH 0:5761 , HOH 0:8389 , ASP H:13BINDING SITE FOR RESIDUE SR 0 8907
235SC4SOFTWAREU 0:146 , G 0:147 , A 0:183 , HOH 0:8265 , ASP M:157BINDING SITE FOR RESIDUE SR 0 8908
236SC5SOFTWAREHOH 0:4603 , HOH 0:7824BINDING SITE FOR RESIDUE SR 0 8909
237SC6SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585BINDING SITE FOR RESIDUE SR 0 8910
238SC7SOFTWAREC 0:85 , A 0:86 , C 0:87 , ASP T:68BINDING SITE FOR RESIDUE SR 0 8911
239SC8SOFTWAREU 0:862 , LYS 1:10 , HOH 1:211BINDING SITE FOR RESIDUE SR 0 8913
240SC9SOFTWAREHOH 0:4220BINDING SITE FOR RESIDUE SR 0 8914
241TC1SOFTWAREU 0:664 , G 0:681BINDING SITE FOR RESIDUE SR 0 8915
242TC2SOFTWAREC 0:1420 , C 0:1421 , G 0:1438BINDING SITE FOR RESIDUE SR 0 8916
243TC3SOFTWAREC 0:478BINDING SITE FOR RESIDUE SR 0 8917
244TC4SOFTWAREA 0:1504 , A 0:1678 , C 0:1679BINDING SITE FOR RESIDUE SR 0 8918
245TC5SOFTWAREG 0:2543 , C 0:2608 , HOH 0:5813 , C 4:74BINDING SITE FOR RESIDUE SR 0 8919
246TC6SOFTWAREG 0:2632BINDING SITE FOR RESIDUE SR 0 8920
247TC7SOFTWAREA 0:1717 , G 0:1718 , HOH 0:4387 , HOH 0:8607BINDING SITE FOR RESIDUE SR 0 8921
248TC8SOFTWAREG 0:471BINDING SITE FOR RESIDUE SR 0 8922
249TC9SOFTWAREG 0:1059 , C 0:1127 , HOH 0:3283 , HOH 0:4195 , HOH 0:8284BINDING SITE FOR RESIDUE SR 0 8923
250UC1SOFTWAREG 0:2725 , G 0:2755 , HOH 0:5775 , HOH 0:6243 , HOH 0:8377BINDING SITE FOR RESIDUE SR 0 8924
251UC2SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 8925
252UC3SOFTWAREA 0:2553BINDING SITE FOR RESIDUE SR 0 8927
253UC4SOFTWAREU 0:1109 , G 0:1110 , A 0:1247BINDING SITE FOR RESIDUE SR 0 8928
254UC5SOFTWAREG 0:1543 , HOH 0:5432BINDING SITE FOR RESIDUE SR 0 8931
255UC6SOFTWAREA 0:532 , U 0:533 , HOH 0:8292BINDING SITE FOR RESIDUE SR 0 8933
256UC7SOFTWAREU 0:777 , U 0:864 , HOH 0:7287 , MG 0:8024 , NA 0:8521BINDING SITE FOR RESIDUE SR 0 8934
257UC8SOFTWAREG 0:2421 , U 0:2422 , C 0:2423BINDING SITE FOR RESIDUE SR 0 8935
258UC9SOFTWAREU 0:909 , A 0:1291 , G 0:1292 , HOH 0:8173BINDING SITE FOR RESIDUE SR 0 8936
259VC1SOFTWAREHOH 0:2940 , HOH 0:7437BINDING SITE FOR RESIDUE SR 0 8937
260VC2SOFTWAREU 0:2445BINDING SITE FOR RESIDUE SR 0 8938
261VC3SOFTWAREG 0:84 , C 0:85 , ASP T:68BINDING SITE FOR RESIDUE SR 0 8939
262VC4SOFTWAREG 0:2466 , ASP L:36BINDING SITE FOR RESIDUE SR 0 8940
263VC5SOFTWAREG 0:1683 , U 0:1696 , HOH 0:3599BINDING SITE FOR RESIDUE SR 0 8941
264VC6SOFTWAREA 0:2746 , U 0:2749 , G 0:2750BINDING SITE FOR RESIDUE SR 0 8942
265VC7SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , G 0:2013 , HOH 0:6101 , HOH 0:7217BINDING SITE FOR RESIDUE SR 0 8943
266VC8SOFTWAREU 0:2016BINDING SITE FOR RESIDUE SR 0 8944
267VC9SOFTWAREC 0:1456 , G 0:1484 , HOH 0:7835 , HOH 0:8273BINDING SITE FOR RESIDUE SR 0 8945
268WC1SOFTWAREG 0:2091BINDING SITE FOR RESIDUE SR 0 8946
269WC2SOFTWAREC 0:1687 , G 0:1688 , C 0:1690BINDING SITE FOR RESIDUE SR 0 8947
270WC3SOFTWAREA 0:2302 , A 0:2303 , HOH 0:8202BINDING SITE FOR RESIDUE SR 0 8948
271WC4SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , HOH 0:8177 , HOH 0:8314BINDING SITE FOR RESIDUE SR 0 8949
272WC5SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 8951
273WC6SOFTWAREU 0:391 , U 0:392 , NA 0:8560 , ARG 3:42BINDING SITE FOR RESIDUE SR 0 8953
274WC7SOFTWAREG 0:2810 , HOH 0:7518BINDING SITE FOR RESIDUE SR 0 8954
275WC8SOFTWAREHOH 0:6225BINDING SITE FOR RESIDUE SR 0 8955
276WC9SOFTWAREA 0:682 , G 0:683 , HOH 0:7891BINDING SITE FOR RESIDUE SR 0 8956
277XC1SOFTWAREC 0:1462 , U 0:1463 , GLY 1:40 , LYS 1:41BINDING SITE FOR RESIDUE SR 0 8957
278XC2SOFTWAREA 0:1133 , G 0:1134BINDING SITE FOR RESIDUE SR 0 8958
279XC3SOFTWAREU 0:1972BINDING SITE FOR RESIDUE SR 0 8959
280XC4SOFTWAREG 0:1113 , A 0:1114 , HOH 0:8252 , HOH 0:8261BINDING SITE FOR RESIDUE SR 0 8960
281XC5SOFTWAREU 0:1432 , G 0:1433 , U 0:1724BINDING SITE FOR RESIDUE SR 0 8962
282XC6SOFTWAREG 0:2284 , G 0:2285 , HOH 0:4621BINDING SITE FOR RESIDUE SR 0 8963
283XC7SOFTWAREG 0:2777 , HOH 0:7189BINDING SITE FOR RESIDUE SR 0 8964
284XC8SOFTWAREHOH 0:7807BINDING SITE FOR RESIDUE SR 0 8965
285XC9SOFTWAREC 0:235BINDING SITE FOR RESIDUE SR 0 8966
286YC1SOFTWAREU 0:2690 , HOH 0:4647BINDING SITE FOR RESIDUE SR 0 8967
287YC2SOFTWAREG 0:2522 , C 9:91BINDING SITE FOR RESIDUE SR 0 8968
288YC3SOFTWAREA 0:565 , G 0:592BINDING SITE FOR RESIDUE SR 0 8970
289YC4SOFTWAREHOH 0:5928 , HOH 0:7102 , HOH 0:7327BINDING SITE FOR RESIDUE SR 0 8973
290YC5SOFTWAREU 0:1835BINDING SITE FOR RESIDUE SR 0 8974
291YC6SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE SR 0 8975
292YC7SOFTWAREG 0:1726BINDING SITE FOR RESIDUE SR 0 8976
293YC8SOFTWAREG 0:2249BINDING SITE FOR RESIDUE SR 0 8977
294YC9SOFTWAREHOH 0:7973BINDING SITE FOR RESIDUE SR 0 8979
295ZC1SOFTWAREG 0:1290 , A 0:1291BINDING SITE FOR RESIDUE SR 0 8981
296ZC2SOFTWAREA 0:1746 , A 0:1747 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 0 8982
297ZC3SOFTWAREG 0:911 , HOH 0:8900BINDING SITE FOR RESIDUE SR 0 8983
298ZC4SOFTWAREA 0:378 , G 0:379 , A 0:429BINDING SITE FOR RESIDUE SR 0 8984
299ZC5SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 0 8985
300ZC6SOFTWAREC 0:1102 , C 0:1103 , GLU J:28BINDING SITE FOR RESIDUE SR 0 8986
301ZC7SOFTWAREG 0:2700BINDING SITE FOR RESIDUE SR 0 8988
302ZC8SOFTWAREA 0:2622 , G 0:2623BINDING SITE FOR RESIDUE SR 0 8989
303ZC9SOFTWAREG 0:2617 , G 0:2618 , HOH 0:7756BINDING SITE FOR RESIDUE SR 0 8990

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3I55)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 3I55)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                3i55 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains 3i55100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh......ee.........ee...................hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                3i55 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains ------------------------------------------------- SCOP domains
               CATH domains 3i55200 2:1-49                                    CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh....hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                3i55 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee........eee.............hhhhhhhhhh.........................ee......ee.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                3i55 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 4 from PDB  Type:DNA/RNA  Length:8
                                         
                3i55 4   74 CCaxxACC  174
                              ||||||
                             76-5AA|
                              77-2OP
                              177-PO2
                               176||
                                175|
                                 174

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                3i55 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55A01 A:1-78 Nucleic acid-binding proteins                                  ---3i55A02 A:82-159  [code=2.30.30.30, no name defined]                          3i55A03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeee.....eeeee...eee...eee...........eee........eee...................eee.........ee.....ee......eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55B01 B:1-38,B:207-257              3i55B02 B:39-77,B:189-206,B:258-337    3i55B03 B:78-188  [code=3.30.1430.10, no name defined]                                                         3i55B02           3i55B01 B:1-38,B:207-257                           3i55B02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eee...eeeeee..eeeeeee........hhhhh.......hhhhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.ee..........eeeeeee..eeeeehhhhhhh....hhhhhh.........................eeee..eeeeeeeeeeeeeee................eeeeeee.........eeee.................ee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3i55C00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee............ee.hhhhhh..hhhhhhhhhhhhhhh..............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eeehhhhh...hhhhhhhhhhhh..hhhhhhhh..ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3i55 C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55D00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh..eeeeeeeee...-----..hhhhhhhhhh...eee.................eeeeee.hhhhhhhhhhhh.....hhhhh....eeee.--------------------.eeeeee....hhhhhh.............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55E01 E:1-79  [code=3.90.930.12, no name defined]                            3i55E02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee.....eeeee...eeeeee...hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeeee..eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55F00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhh....eehhhhhhhhhhhh....eeee.....hhhhhhhhhhh......eeee.hhhhhhhhh.......eee......hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3i55 G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55H00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh........................................eeeee...eeeehhhhhhhhhhhhhhhhhhhh.......ee.....eeeee..-----------........eeeeeeeee....eeee......hhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains 3i55I00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh................eehhhhhhhhh..........hhhhhhhhhh........ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                3i55 I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55J00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeee.hhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhh.eee........................eeehhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3i55K00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......ee...ee...eeee.......eeeeeee...........ee....eeeeee..........eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3i55 K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3i55L01 L:1-50                                    3i55L02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh..............................................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhh....eee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3i55 L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55M00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh....hhhhhhhhhhhhhhh....eee.....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeeee..eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 M    1 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3i55N00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhh...eeeeee....eeeeeee......eeee...hhhhhhhh......hhhhhhhhhhhhhhhhhh......eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3i55 N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55O00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...hhhhhhhhhh......eee.hhhhhhhh....eeeeeeee..........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55P01 P:1-55  [code=1.10.1650.10, no name defined]   3i55P02 P:56-88 Single Heli x bin3i55P03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55Q00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhh................eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                3i55 Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3i55R00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........hhh.eeeeeeeeee.hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeeee..eeeehhheeee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3i55 R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains --------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55S00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhh...eeeeeee......eeeeeee....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                3i55 S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55T00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhhheeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains 3i55U00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                3i55 U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains 3i55V00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                3i55 V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55W01 W:1-57,W:114-154                                 3i55W02 W:58-113  [code=1.10.15.30, no name defined]    3i55W01 W:1-57,W:114-154                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eee...hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhhh..hhhhhh....ee.....................ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55X00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.........hhhhhhhhhhhhhhhhhhhhh......eeehhhhhhhhhh..........eeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3i55 X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee..hhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3i55 Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains ------------------------------------------------------------------------- SCOP domains
               CATH domains 3i55Z00 Z:34-106  [code=2.20.25.30, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh...............................eee....eeee......ee.......hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                3i55 Z   34 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS  106
                                    43        53        63        73        83        93       103   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3I55)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
01a3i55D00D:10-174
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
02a3i55F00F:1-119
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
03a3i55S00S:1-81
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
04a3i55N00N:1-186
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
05a3i55W01W:1-57,W:114-154
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
06a3i55B03B:78-188
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
07a3i55M00M:1-194
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
08a3i55C00C:1-246
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
09a3i55H00H:4-174
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
10a3i55E01E:1-79
10b3i55E02E:80-172
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
11a3i55J00J:4-145
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
12a3i55R00R:1-150
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
13a3i55O00O:1-115
13b3i55L02L:51-149
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
14a3i553003:1-92
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
15a3i55X00X:7-88
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
16a3i55L01L:1-50
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
17a3i55A03A:160-237
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
18a3i55B01B:1-38,B:207-257
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
19a3i55W02W:58-113
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
20a3i55P01P:1-55
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
21a3i55I00I:66-135
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
22a3i552002:1-49
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
23a3i55V00V:1-65
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
24a3i55P03P:89-143
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
25a3i55P02P:56-88
(-)
Class: Mainly Beta (13760)
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
26a3i55B02B:39-77,B:189-206,B:258-337
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
27a3i55A01A:1-78
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
28a3i55K00K:1-132
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
29a3i55U00U:4-56
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
30a3i55A02A:82-159
30b3i55T00T:1-119
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
31a3i55Q00Q:1-95
(-)
Haloarcula marismortui atcc 43049. Organism_taxid: 272569. Haloarculamarismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui.Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui.Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238.Haloarcula marismortui. Halobacterium marismortui. Organism_taxid: 2238. Haloarcula marismortui. Halobacterium marismortui. Organism_taxid:2238. Haloarcula marismortui. Organism_taxid: 2238. (1)
32a3i551001:1-56
32b3i55Z00Z:34-106

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3I55)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    2OP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    5AA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MYL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [