Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF THE TRANSITION STATE ANALOGUE "DAN" BOUND TO THE LARGE RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  T. M. Schmeing, T. A. Steitz
Date :  16 Dec 04  (Deposition) - 29 Nov 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,9
Keywords :  Ribosome 50S, Protein-Protein Complex, Rna-Rna Complex, Protein-Rna Complex, Peptidyl Transferase Reaction, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. M. Schmeing, K. S. Huang, D. E. Kitchen, S. A. Strobel, T. A. Steitz
Structural Insights Into The Roles Of Water And The 2' Hydroxyl Of The P Site Trna In The Peptidyl Transferase Reaction.
Mol. Cell V. 20 437 2005
PubMed-ID: 16285925  |  Reference-DOI: 10.1016/J.MOLCEL.2005.09.006

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 3 - 5'-R(*CP*CP*(PPU)P*(PO2)P*(DA)P*C*C)-3')
    Chains4
    EngineeredYES
    Other DetailsSYNTHETIC OLIGO C-C-PUROMYCIN-PO2-DA-C-C
    SyntheticYES
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L4E
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 32 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526272829303132
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ012349

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (15, 322)

Asymmetric/Biological Unit (15, 322)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2C2Ligand/IonCYTIDINE-5'-MONOPHOSPHATE
3CD5Ligand/IonCADMIUM ION
4CL22Ligand/IonCHLORIDE ION
5DA1Ligand/Ion2'-DEOXYADENOSINE-5'-MONOPHOSPHATE
6K2Ligand/IonPOTASSIUM ION
7MG94Ligand/IonMAGNESIUM ION
8NA75Ligand/IonSODIUM ION
9OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
10OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
11PO21Mod. NucleotideHYPOPHOSPHITE
12PPU1Mod. NucleotidePUROMYCIN-5'-MONOPHOSPHATE
13PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
14SR114Ligand/IonSTRONTIUM ION
15UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (315, 315)

Asymmetric Unit (315, 315)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2284 , A 0:2474 , A 0:2485 , A 0:2486 , A 0:2637 , MG 0:8118 , HOH 0:8448 , HOH 0:8456 , PPU 4:76 , PO2 4:178 , C 4:180 , HOH 4:7911 , HOH 4:7932BINDING SITE FOR RESIDUE DA 4 179
002AC2SOFTWAREC 0:2104 , C 0:2105 , G 0:2284 , G 0:2285 , C 0:2636 , A 0:2637 , MG 0:8118 , HOH 0:8448 , DA 4:179 , C 4:181 , HOH 4:7911 , HOH 4:7922 , HOH 4:7931 , HOH 4:7932BINDING SITE FOR RESIDUE C 4 180
003AC3SOFTWAREG 0:2285 , G 0:2286 , C 0:2636 , C 4:180 , HOH 4:7013BINDING SITE FOR RESIDUE C 4 181
004AC4SOFTWAREG 0:2482 , A 0:2483 , A 0:2532 , C 0:2533 , C 0:2534 , HOH 0:4216 , HOH 0:8310 , HOH 0:9801BINDING SITE FOR RESIDUE MG 0 8001
005AC5SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , U 0:2535 , HOH 0:8288 , HOH 0:8289 , HOH 0:9886BINDING SITE FOR RESIDUE MG 0 8002
006AC6SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:4264 , HOH A:9500 , HOH A:9523BINDING SITE FOR RESIDUE MG 0 8003
007AC7SOFTWAREG 0:456 , A 0:459 , HOH 0:3391 , HOH 0:4379 , HOH 0:8295 , HOH 0:9672BINDING SITE FOR RESIDUE MG 0 8004
008AC8SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4212 , HOH 0:8311 , HOH 0:8312BINDING SITE FOR RESIDUE MG 0 8005
009AC9SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:4230 , HOH 0:8304 , HOH 0:8384BINDING SITE FOR RESIDUE MG 0 8008
010AD1SOFTWAREG 0:33 , C 0:34 , U 0:457 , HOH C:9153BINDING SITE FOR RESIDUE SR 0 9500
011AD2SOFTWAREHOH 0:4103 , HOH 0:6383BINDING SITE FOR RESIDUE SR 0 9501
012AD3SOFTWAREG 0:1290 , A 0:1291 , HOH 0:5528 , HOH 0:8386BINDING SITE FOR RESIDUE SR 0 9504
013AD4SOFTWAREA 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 0 9505
014AD5SOFTWAREA 0:632 , C 0:633 , A 0:2538 , U 0:2539 , HOH 0:4245 , HOH 0:5426 , HOH 0:8446BINDING SITE FOR RESIDUE SR 0 9506
015AD6SOFTWAREG 0:911 , G 0:1292 , HOH 0:3420 , HOH 0:3666 , HOH 0:3999BINDING SITE FOR RESIDUE SR 0 9508
016AD7SOFTWAREA 0:378 , G 0:379 , A 0:429 , HOH 0:5138 , HOH 0:7953BINDING SITE FOR RESIDUE SR 0 9509
017AD8SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 0 9515
018AD9SOFTWAREC 0:1103 , HOH 0:3168 , GLU J:28BINDING SITE FOR RESIDUE SR 0 9517
019BC1SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4335 , HOH 0:7899 , HOH 0:8305 , NA 0:9158 , HOH 0:9959BINDING SITE FOR RESIDUE MG 0 8009
020BC2SOFTWAREG 0:28 , HOH 0:3258 , HOH 0:3833 , HOH 0:4246 , HOH 0:8385 , HOH 0:9664BINDING SITE FOR RESIDUE MG 0 8012
021BC3SOFTWAREG 0:877 , G 0:2623 , A 0:2624 , HOH 0:4241 , HOH 0:8319BINDING SITE FOR RESIDUE MG 0 8013
022BC4SOFTWAREA 0:2101 , G 0:2102 , G 0:2537 , HOH 0:4215BINDING SITE FOR RESIDUE MG 0 8014
023BC5SOFTWAREA 0:844 , A 0:1689 , HOH 0:4222 , HOH 0:8320 , HOH 0:9633 , HOH 0:9650BINDING SITE FOR RESIDUE MG 0 8015
024BC6SOFTWAREG 0:456 , HOH 0:3043 , HOH 0:8296 , GLY C:86 , HOH C:9164 , HOH C:9168 , HOH C:9271BINDING SITE FOR RESIDUE MG 0 8017
025BC7SOFTWAREA 0:2011 , HOH 0:4741 , HOH 0:7724 , HOH 0:8315 , HOH 0:8316 , HOH 0:8317BINDING SITE FOR RESIDUE MG 0 8019
026BC8SOFTWAREC 0:1830 , HOH 0:8299 , HOH 0:8318 , HOH 0:9747 , HOH 0:9750 , HOH 0:9822BINDING SITE FOR RESIDUE MG 0 8020
027BC9SOFTWAREG 0:2304 , HOH 0:3574 , HOH 0:4237 , HOH 0:4238 , HOH 0:8302 , HOH 0:8303BINDING SITE FOR RESIDUE MG 0 8021
028BD1SOFTWAREG 0:2700BINDING SITE FOR RESIDUE SR 0 9522
029BD2SOFTWAREA 0:2622 , G 0:2623 , HOH 0:5205 , HOH 0:7699BINDING SITE FOR RESIDUE SR 0 9529
030BD3SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4228 , HOH 0:4414 , HOH 0:8322 , HOH 0:8453BINDING SITE FOR RESIDUE SR 0 9530
031BD4SOFTWAREA 0:1427BINDING SITE FOR RESIDUE SR 0 9532
032BD5SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3212 , HOH 0:4357BINDING SITE FOR RESIDUE SR 0 9534
033BD6SOFTWAREA 0:1941BINDING SITE FOR RESIDUE SR 0 9537
034BD7SOFTWAREA 0:846 , G 0:1694 , G 0:1695BINDING SITE FOR RESIDUE SR 0 9539
035BD8SOFTWAREG 0:2609 , U 0:2610 , HOH 0:3904 , HOH 0:4318 , HOH 0:6157 , HOH 0:7989BINDING SITE FOR RESIDUE SR 0 9545
036BD9SOFTWAREA 0:1411 , HOH 0:6119 , HOH 0:7581BINDING SITE FOR RESIDUE SR 0 9547
037CC1SOFTWAREG 0:2097 , U 0:2539 , G 0:2540 , HOH 0:4321 , HOH 0:5293 , HOH 0:9736BINDING SITE FOR RESIDUE MG 0 8022
038CC2SOFTWAREA 0:1381 , HOH 0:3548BINDING SITE FOR RESIDUE MG 0 8024
039CC3SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4759 , HOH 0:8323BINDING SITE FOR RESIDUE MG 0 8025
040CC4SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:3022 , HOH 0:8324 , HOH 0:8325BINDING SITE FOR RESIDUE MG 0 8026
041CC5SOFTWAREC 0:240 , G 0:269 , HOH 0:4467 , HOH 0:4605 , HOH 0:4746 , HOH 0:8390BINDING SITE FOR RESIDUE MG 0 8027
042CC6SOFTWAREA 0:1448 , U 0:1677 , HOH 0:4276 , HOH 0:4297 , HOH 0:4308 , HOH 0:8328BINDING SITE FOR RESIDUE MG 0 8028
043CC7SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:8330 , HOH 0:8332BINDING SITE FOR RESIDUE MG 0 8029
044CC8SOFTWAREU 0:1748 , U 0:1749 , HOH 0:4239 , HOH 0:8297 , HOH 0:8298 , HOH 0:8308BINDING SITE FOR RESIDUE MG 0 8030
045CC9SOFTWAREU 0:777 , C 0:778 , HOH 0:3881 , HOH 0:8333 , SR 0:9441 , HOH 1:9511BINDING SITE FOR RESIDUE MG 0 8031
046CD1SOFTWAREHOH 0:6275BINDING SITE FOR RESIDUE SR 0 9560
047CD2SOFTWAREG 0:834 , U 0:835 , C 0:2644 , HOH 0:3986 , HOH 0:4503 , HOH 0:5047 , HOH 0:6661BINDING SITE FOR RESIDUE SR 0 9566
048CD3SOFTWAREU 0:2461 , HOH 0:6774 , ASP 3:59BINDING SITE FOR RESIDUE SR 0 9568
049CD4SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9570
050CD5SOFTWAREU 0:1996 , U 0:2589 , U 0:2590 , C 0:2591 , HOH 0:6151 , HOH 0:6466BINDING SITE FOR RESIDUE SR 0 9581
051CD6SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9585
052CD7SOFTWAREG 0:2102 , A 0:2103 , HOH 0:4215BINDING SITE FOR RESIDUE SR 0 9590
053CD8SOFTWAREG 0:2639BINDING SITE FOR RESIDUE SR 0 9601
054CD9SOFTWAREG 0:1376 , A 0:1693 , HOH 0:5058BINDING SITE FOR RESIDUE SR 0 9626
055DC1SOFTWAREU 0:2115 , G 0:2272 , HOH 0:3600 , HOH 0:4384 , HOH 0:4778 , HOH 0:8334 , ALA A:196 , HOH A:9539BINDING SITE FOR RESIDUE MG 0 8032
056DC2SOFTWAREG 0:956 , HOH 0:4268 , HOH 0:8337 , HOH 0:8338 , HOH 0:8339 , HOH 0:9993BINDING SITE FOR RESIDUE MG 0 8036
057DC3SOFTWAREA 0:2553 , HOH 0:3742 , HOH 0:3816 , HOH 0:4247 , HOH 0:8394 , HOH 0:9703BINDING SITE FOR RESIDUE MG 0 8037
058DC4SOFTWAREHOH 0:4226 , HOH 0:4248 , HOH 0:4269 , HOH 0:4271 , HOH 0:8341 , HOH 0:9908BINDING SITE FOR RESIDUE MG 0 8038
059DC5SOFTWAREU 0:115 , HOH 0:3524 , HOH 0:4559 , HOH 0:5661 , HOH 0:6211BINDING SITE FOR RESIDUE MG 0 8039
060DC6SOFTWAREU 0:172 , U 0:392 , HOH 0:8395 , HOH M:9340BINDING SITE FOR RESIDUE MG 0 8040
061DC7SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:4698 , HOH 0:4789BINDING SITE FOR RESIDUE MG 0 8041
062DC8SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3064 , HOH 0:4256 , HOH 0:4997 , HOH 0:8344BINDING SITE FOR RESIDUE MG 0 8042
063DC9SOFTWAREG 0:816 , G 0:817 , HOH 0:3427 , HOH 0:7888 , MG 0:8106 , HOH 0:8397BINDING SITE FOR RESIDUE MG 0 8043
064DD1SOFTWAREU 0:1368 , HOH 0:5442 , HOH 0:6339 , HOH 0:6396 , HOH R:9468BINDING SITE FOR RESIDUE SR 0 9629
065DD2SOFTWAREA 9:3056 , A 9:3057 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8095
066DD3SOFTWAREC 9:3040 , ARG D:51BINDING SITE FOR RESIDUE NA 9 9151
067DD4SOFTWAREA 0:955 , HOH 0:7121 , C 9:3081 , U 9:3082BINDING SITE FOR RESIDUE NA 9 9152
068DD5SOFTWAREG 9:3021 , G 9:3022 , U 9:3055 , A 9:3057 , G 9:3058BINDING SITE FOR RESIDUE NA 9 9183
069DD6SOFTWAREHOH 0:5562 , C 9:3091 , HOH H:9525BINDING SITE FOR RESIDUE SR 9 9481
070DD7SOFTWAREG 9:3078 , G 9:3102BINDING SITE FOR RESIDUE SR 9 9503
071DD8SOFTWAREHOH 9:120 , A 9:3044 , HOH 9:4351BINDING SITE FOR RESIDUE SR 9 9588
072DD9SOFTWAREG 0:1873 , HOH 0:4930 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120BINDING SITE FOR RESIDUE MG A 8066
073EC1SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3900 , GLY R:65 , HOH R:9504BINDING SITE FOR RESIDUE MG 0 8044
074EC2SOFTWAREG 0:1979 , HOH 0:8345 , HOH 0:8398 , HOH 0:8400BINDING SITE FOR RESIDUE MG 0 8045
075EC3SOFTWAREG 0:1794 , HOH 0:7778 , HOH 0:8401 , HOH 0:8402BINDING SITE FOR RESIDUE MG 0 8046
076EC4SOFTWAREG 0:1099 , HOH 0:5070 , HOH 0:7556 , HOH 0:8414BINDING SITE FOR RESIDUE MG 0 8047
077EC5SOFTWAREC 0:2248BINDING SITE FOR RESIDUE MG 0 8050
078EC6SOFTWAREG 0:641 , A 0:1355 , HOH 0:4694 , HOH 0:8346 , HOH 0:8347BINDING SITE FOR RESIDUE MG 0 8051
079EC7SOFTWAREU 0:1125 , HOH 0:8416 , HOH 9:737 , G 9:3090BINDING SITE FOR RESIDUE MG 0 8052
080EC8SOFTWAREC 0:162 , U 0:2276 , HOH 0:3060 , HOH 0:8301 , HOH 0:8348 , HOH 0:8349BINDING SITE FOR RESIDUE MG 0 8054
081EC9SOFTWAREA 0:2757 , HOH 0:4266 , HOH 0:8368 , ASN B:335 , HOH B:9540BINDING SITE FOR RESIDUE MG 0 8056
082ED1SOFTWAREHOH 0:6917 , LYS A:175 , LYS A:178BINDING SITE FOR RESIDUE CL A 9309
083ED2SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9546 , HOH A:9589BINDING SITE FOR RESIDUE SR A 9436
084ED3SOFTWAREHOH 0:4930 , HOH 0:6475 , HOH 0:8432 , GLU A:28BINDING SITE FOR RESIDUE SR A 9437
085ED4SOFTWAREGLU A:28BINDING SITE FOR RESIDUE SR A 9497
086ED5SOFTWAREGLY B:337 , HOH B:9551 , HOH B:9656 , HOH B:9657BINDING SITE FOR RESIDUE MG B 8055
087ED6SOFTWAREHOH 0:3205 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 9319
088ED7SOFTWAREHOH 0:3560 , HOH 0:3852 , ASN B:243 , SER B:245BINDING SITE FOR RESIDUE SR B 9458
089ED8SOFTWAREC 0:2672 , GLU B:163 , ARG B:310BINDING SITE FOR RESIDUE SR B 9521
090ED9SOFTWAREASP C:45 , THR C:94 , LYS C:96 , HOH C:9110BINDING SITE FOR RESIDUE NA C 9104
091FC1SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5575 , HOH 0:8351 , HOH 0:8417 , GLN A:207BINDING SITE FOR RESIDUE MG 0 8057
092FC2SOFTWAREG 0:1884 , G 0:2013 , HOH 0:4360 , HOH 0:8350 , HOH 0:8351BINDING SITE FOR RESIDUE MG 0 8058
093FC3SOFTWAREG 0:2618 , HOH 0:4319 , HOH 0:8309 , HOH 0:9663 , HOH 0:9667BINDING SITE FOR RESIDUE MG 0 8059
094FC4SOFTWAREG 0:175 , U 0:224 , HOH 0:8354 , HOH 0:8355 , HOH 0:9795BINDING SITE FOR RESIDUE MG 0 8060
095FC5SOFTWAREA 0:1369 , U 0:2650 , HOH 0:8356 , HOH 0:8357 , HOH 0:8358BINDING SITE FOR RESIDUE MG 0 8061
096FC6SOFTWAREG 0:1364 , HOH 0:4770 , HOH 0:5594 , HOH 0:7508 , HOH 0:7906 , HOH 0:8294 , HOH 0:8367BINDING SITE FOR RESIDUE MG 0 8063
097FC7SOFTWAREG 0:782 , C 0:783 , HOH 0:4563 , HOH A:9511 , HOH A:9590 , HOH A:9619BINDING SITE FOR RESIDUE MG 0 8065
098FC8SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8360 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8067
099FC9SOFTWAREA 0:2569 , HOH 0:4348 , HOH 0:5393 , HOH 0:7183 , HOH E:920BINDING SITE FOR RESIDUE MG 0 8068
100FD1SOFTWAREHOH 0:5665BINDING SITE FOR RESIDUE SR F 9595
101FD2SOFTWAREARG H:114BINDING SITE FOR RESIDUE NA H 9122
102FD3SOFTWAREA 0:1133 , G 0:1134 , TYR H:154 , ILE H:157 , THR H:158 , PRO H:159BINDING SITE FOR RESIDUE SR H 9486
103FD4SOFTWAREHOH 0:3110 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69 , HOH J:4949BINDING SITE FOR RESIDUE NA J 9146
104FD5SOFTWAREASN J:126 , ILE J:127 , LYS J:128 , HOH J:4193BINDING SITE FOR RESIDUE CL J 9301
105FD6SOFTWAREPRO J:88 , LYS J:90 , LYS J:91BINDING SITE FOR RESIDUE CL J 9302
106FD7SOFTWAREGLY J:64 , ASN J:65 , TYR J:69 , HOH J:4949BINDING SITE FOR RESIDUE CL J 9321
107FD8SOFTWAREHOH 0:4025 , HOH 0:4825 , HOH 0:6580 , ASN K:42 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8069
108FD9SOFTWARELYS L:52 , ARG L:53BINDING SITE FOR RESIDUE CL L 9310
109GC1SOFTWAREA 0:166 , G 0:219 , HOH 0:4410 , HOH 0:5524 , HOH 0:6146 , HOH 0:9748BINDING SITE FOR RESIDUE MG 0 8070
110GC2SOFTWAREU 0:954 , C 0:2298 , HOH 0:4588 , HOH 0:8420BINDING SITE FOR RESIDUE MG 0 8072
111GC3SOFTWAREA 0:1286 , A 0:1287 , HOH 0:8361 , HOH 0:8362 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8074
112GC4SOFTWAREA 0:907 , A 0:908 , HOH 0:4236 , HOH 0:4510 , HOH 0:5503 , HOH 0:8363BINDING SITE FOR RESIDUE MG 0 8075
113GC5SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:4211 , HOH 0:4217 , HOH 0:4229BINDING SITE FOR RESIDUE MG 0 8079
114GC6SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4793 , HOH 0:7194 , HOH 0:8373 , HOH 0:8424BINDING SITE FOR RESIDUE MG 0 8080
115GC7SOFTWAREHOH 0:5716 , HOH 0:5802 , HOH 0:8434BINDING SITE FOR RESIDUE MG 0 8082
116GC8SOFTWAREC 0:1753 , A 0:1754 , HOH 0:4305 , HOH 0:4742 , HOH 0:8374 , HOH 0:8425BINDING SITE FOR RESIDUE MG 0 8083
117GC9SOFTWAREU 0:1741 , A 0:1742 , G 0:1743 , HOH 0:3367 , HOH 0:4234 , HOH 0:8375BINDING SITE FOR RESIDUE MG 0 8084
118GD1SOFTWAREHOH 0:4254 , HOH 0:9905 , ARG L:27 , GLU L:39 , HOH L:9434 , HOH L:9491BINDING SITE FOR RESIDUE SR L 9409
119GD2SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:9429BINDING SITE FOR RESIDUE NA M 9147
120GD3SOFTWARESER M:106 , ARG M:113 , VAL M:114 , VAL M:159BINDING SITE FOR RESIDUE CL M 9318
121GD4SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 9307
122GD5SOFTWAREHIS O:40 , HOH O:5650BINDING SITE FOR RESIDUE CD O 9205
123GD6SOFTWAREASN O:44BINDING SITE FOR RESIDUE CL O 9308
124GD7SOFTWAREASN Q:16 , ASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427BINDING SITE FOR RESIDUE NA Q 9148
125GD8SOFTWARESER R:70 , VAL R:72 , NA R:9138 , HOH R:9438 , HOH R:9439 , HOH R:9472BINDING SITE FOR RESIDUE NA R 9137
126GD9SOFTWAREU 0:2659 , G 0:2660 , VAL R:72 , TRP R:75 , NA R:9137 , HOH R:9427 , HOH R:9439BINDING SITE FOR RESIDUE NA R 9138
127HC1SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4938 , HOH 0:5061BINDING SITE FOR RESIDUE MG 0 8085
128HC2SOFTWAREG 0:2540 , G 0:2611 , HOH 0:4876 , NA 0:9139 , HOH 0:9689 , HOH 0:9922BINDING SITE FOR RESIDUE MG 0 8088
129HC3SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:8426 , HOH 0:8427BINDING SITE FOR RESIDUE MG 0 8089
130HC4SOFTWAREA 0:2103 , A 0:2479 , HOH 0:4215 , HOH 0:4257 , HOH 0:4390BINDING SITE FOR RESIDUE MG 0 8090
131HC5SOFTWAREG 0:918 , HOH 0:3171 , HOH 0:3928 , HOH 0:7000 , HOH 0:8379 , HOH 0:9718BINDING SITE FOR RESIDUE MG 0 8091
132HC6SOFTWAREA 0:1843 , C 0:1844 , HOH 0:3013 , HOH 0:4243 , HOH 0:8428BINDING SITE FOR RESIDUE MG 0 8092
133HC7SOFTWAREG 0:627 , A 0:1070 , G 0:1071 , HOH 0:3306 , HOH 0:4249 , HOH 0:4280 , HOH 0:4320BINDING SITE FOR RESIDUE MG 0 8093
134HC8SOFTWAREU 0:1096 , G 0:1258 , HOH 0:8380BINDING SITE FOR RESIDUE MG 0 8094
135HC9SOFTWAREG 0:1848 , G 0:1849 , HOH 0:4261 , HOH 0:4298 , HOH 0:4428 , HOH 0:4459BINDING SITE FOR RESIDUE MG 0 8096
136HD1SOFTWAREU 0:12 , LYS R:60 , GLN R:61 , ASN R:63 , SR R:9418BINDING SITE FOR RESIDUE NA R 9186
137HD2SOFTWARELYS R:118 , HOH R:9421BINDING SITE FOR RESIDUE CL R 9306
138HD3SOFTWAREGLN R:61 , ASN R:63 , NA R:9186BINDING SITE FOR RESIDUE SR R 9418
139HD4SOFTWAREHIS S:7 , GLU S:61 , HOH S:9483BINDING SITE FOR RESIDUE NA S 9112
140HD5SOFTWAREHOH 0:8421 , ASP S:59BINDING SITE FOR RESIDUE SR S 9470
141HD6SOFTWARETYR T:35 , GLN T:37 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8073
142HD7SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 9201
143HD8SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:9361 , HOH Y:9381 , HOH Y:9413BINDING SITE FOR RESIDUE MG Y 8109
144HD9SOFTWAREA 0:1328 , HOH 0:5503 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 9320
145IC1SOFTWAREU 0:862 , G 0:863 , U 0:864 , HOH 0:3943 , HOH 0:4270 , HOH 0:6109BINDING SITE FOR RESIDUE MG 0 8097
146IC2SOFTWAREA 0:907 , HOH 0:3554 , HOH 0:3972 , HOH 0:4282 , HOH 0:4344 , HOH Y:9368BINDING SITE FOR RESIDUE MG 0 8098
147IC3SOFTWAREA 0:2612 , G 0:2613 , HOH 0:3624 , HOH 0:4265 , HOH 0:5035BINDING SITE FOR RESIDUE MG 0 8099
148IC4SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4343 , HOH 0:5192BINDING SITE FOR RESIDUE MG 0 8101
149IC5SOFTWAREA 0:2434 , U 0:2458 , HOH 0:8439 , HOH 0:9878 , HOH 3:9448 , HOH 3:9459BINDING SITE FOR RESIDUE MG 0 8102
150IC6SOFTWAREG 0:2578 , G 0:2579 , HOH 0:8430BINDING SITE FOR RESIDUE MG 0 8103
151IC7SOFTWAREC 0:2104 , C 0:2105 , HOH 0:8291BINDING SITE FOR RESIDUE MG 0 8104
152IC8SOFTWAREG 0:817 , HOH 0:4201 , HOH 0:7883 , HOH 0:7888 , MG 0:8043 , HOH 0:8397 , HOH P:182BINDING SITE FOR RESIDUE MG 0 8106
153IC9SOFTWAREC 0:1104 , A 0:1106 , A 0:1107 , HOH 0:8408 , HOH J:7851BINDING SITE FOR RESIDUE MG 0 8107
154ID1SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 9203
155ID2SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 9202
156ID3SOFTWAREU 0:862 , HOH 0:5451 , HOH 0:9793 , LYS 1:10 , ASN 1:12 , HOH 1:9501BINDING SITE FOR RESIDUE SR 1 9419
157ID4SOFTWAREHOH 0:3835 , HOH 0:4476 , HOH 0:9926 , ASP 1:47 , HOH 1:9475 , HOH 1:9485BINDING SITE FOR RESIDUE SR 1 9460
158ID5SOFTWAREHOH 0:7359 , HOH 0:8370 , HOH 0:8421 , HOH 0:8422 , HOH 2:7875BINDING SITE FOR RESIDUE MG 2 8076
159ID6SOFTWAREU 0:392 , HOH 0:3366 , HOH 0:7597 , SR 0:9461 , ARG 3:42 , ASN 3:43BINDING SITE FOR RESIDUE NA 3 9169
160ID7SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74BINDING SITE FOR RESIDUE CD 3 9204
161ID8SOFTWARETHR 3:65 , ASP 3:66BINDING SITE FOR RESIDUE CL 3 9304
162ID9SOFTWAREHOH 0:4551 , HOH 0:8423 , GLY 3:45 , GLY 3:47 , ASP 3:49BINDING SITE FOR RESIDUE SR 3 9439
163JC1SOFTWAREHOH 0:5545 , HOH 0:8409 , HOH 0:8410 , HOH 0:8411BINDING SITE FOR RESIDUE MG 0 8108
164JC2SOFTWAREU 0:903 , A 0:1357 , HOH 0:3133 , HOH 0:4520 , HOH 0:5956 , HOH 0:6569BINDING SITE FOR RESIDUE MG 0 8110
165JC3SOFTWAREA 0:187 , HOH 0:3193 , HOH 0:4323 , HOH 0:4364 , HOH 0:9754 , HOH 0:9956BINDING SITE FOR RESIDUE MG 0 8112
166JC4SOFTWAREA 0:2112 , HOH 0:3212 , HOH 0:4349 , HOH 0:4518 , HOH 0:6666 , HOH 0:6922BINDING SITE FOR RESIDUE MG 0 8113
167JC5SOFTWAREA 0:2430 , HOH 0:3077 , HOH 0:4558 , HOH 0:5389 , HOH 0:9974BINDING SITE FOR RESIDUE MG 0 8114
168JC6SOFTWAREHOH 0:4884 , HOH 0:7118 , MG 0:8116 , HOH A:9543BINDING SITE FOR RESIDUE MG 0 8115
169JC7SOFTWAREU 0:1850 , HOH 0:4261 , HOH 0:4286 , HOH 0:4459 , MG 0:8115 , HOH A:9543BINDING SITE FOR RESIDUE MG 0 8116
170JC8SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:9851BINDING SITE FOR RESIDUE MG 0 8117
171JC9SOFTWAREA 0:2637 , HOH 0:8448 , HOH 0:8449 , DA 4:179 , C 4:180 , HOH 4:7911BINDING SITE FOR RESIDUE MG 0 8118
172KC1SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 9001
173KC2SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:9642 , HOH 0:9737 , ARG M:82 , HOH M:9325BINDING SITE FOR RESIDUE K 0 9002
174KC3SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3775 , HOH 0:3806 , HOH 0:5535BINDING SITE FOR RESIDUE NA 0 9101
175KC4SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:8323BINDING SITE FOR RESIDUE NA 0 9102
176KC5SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:4680 , HOH 0:5273 , HOH 0:6337BINDING SITE FOR RESIDUE NA 0 9105
177KC6SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9752BINDING SITE FOR RESIDUE NA 0 9106
178KC7SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 9107
179KC8SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4015 , SR 0:9473BINDING SITE FOR RESIDUE NA 0 9108
180KC9SOFTWAREA 0:2577 , G 0:2578 , G 0:2579BINDING SITE FOR RESIDUE NA 0 9110
181LC1SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:4178 , HOH 0:5223BINDING SITE FOR RESIDUE NA 0 9111
182LC2SOFTWAREG 0:2399 , HOH 0:3563 , HOH 0:4429 , HOH 0:5632 , HOH 0:5680BINDING SITE FOR RESIDUE NA 0 9113
183LC3SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3737 , HOH 0:9957 , TRP B:242BINDING SITE FOR RESIDUE NA 0 9114
184LC4SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:3309BINDING SITE FOR RESIDUE NA 0 9115
185LC5SOFTWAREC 0:896 , A 0:897 , HOH 0:6841 , HOH 0:8226BINDING SITE FOR RESIDUE NA 0 9116
186LC6SOFTWAREG 0:1416 , G 0:1417 , HOH 0:5715 , HOH 0:9902 , TRP 2:42 , ASN 2:45BINDING SITE FOR RESIDUE NA 0 9117
187LC7SOFTWAREG 0:2543 , G 0:2544 , HOH 0:4524 , HOH 0:7971 , NA 0:9120 , HOH 0:9837BINDING SITE FOR RESIDUE NA 0 9118
188LC8SOFTWAREG 0:2543 , G 0:2544 , U 0:2615 , HOH 0:3358 , NA 0:9118BINDING SITE FOR RESIDUE NA 0 9120
189LC9SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:5056BINDING SITE FOR RESIDUE NA 0 9123
190MC1SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:3118 , HOH 0:4719 , HOH 0:7646BINDING SITE FOR RESIDUE NA 0 9124
191MC2SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3247 , HOH 0:3881 , HOH 0:8202 , SR 0:9441BINDING SITE FOR RESIDUE NA 0 9125
192MC3SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012 , HOH 0:3203BINDING SITE FOR RESIDUE NA 0 9126
193MC4SOFTWAREU 0:821 , C 0:822 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3345 , HOH 0:3810BINDING SITE FOR RESIDUE NA 0 9127
194MC5SOFTWAREG 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5774 , HOH 0:6996BINDING SITE FOR RESIDUE NA 0 9128
195MC6SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:7095BINDING SITE FOR RESIDUE NA 0 9129
196MC7SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9861BINDING SITE FOR RESIDUE NA 0 9130
197MC8SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:3175 , HOH 0:9925BINDING SITE FOR RESIDUE NA 0 9131
198MC9SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7569BINDING SITE FOR RESIDUE NA 0 9132
199NC1SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5808 , HOH 0:8442BINDING SITE FOR RESIDUE NA 0 9134
200NC2SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3487BINDING SITE FOR RESIDUE NA 0 9135
201NC3SOFTWAREG 0:1706 , G 0:1707 , HOH 0:3538 , HOH 0:5894 , HOH 0:7826 , HOH 0:8229BINDING SITE FOR RESIDUE NA 0 9136
202NC4SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , HOH 0:3636 , HOH 0:4876 , MG 0:8088 , HOH 0:9922BINDING SITE FOR RESIDUE NA 0 9139
203NC5SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3645 , HOH 0:6805 , HOH 0:7328BINDING SITE FOR RESIDUE NA 0 9140
204NC6SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:4610 , HOH 0:8435BINDING SITE FOR RESIDUE NA 0 9141
205NC7SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 0 9143
206NC8SOFTWAREA 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045 , HOH 0:6143BINDING SITE FOR RESIDUE NA 0 9149
207NC9SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:7465BINDING SITE FOR RESIDUE NA 0 9150
208OC1SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5390 , HOH 0:8138BINDING SITE FOR RESIDUE NA 0 9154
209OC2SOFTWAREG 0:1119 , C 0:1243 , HOH 0:5382 , THR J:47BINDING SITE FOR RESIDUE NA 0 9155
210OC3SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , A 0:2467 , HOH 0:3080BINDING SITE FOR RESIDUE NA 0 9156
211OC4SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:6804BINDING SITE FOR RESIDUE NA 0 9157
212OC5SOFTWAREG 0:2611 , HOH 0:3111 , HOH 0:4335 , MG 0:8009 , HOH 0:8321 , HOH 0:9959 , TRP B:242BINDING SITE FOR RESIDUE NA 0 9158
213OC6SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 9159
214OC7SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6495 , SR 0:9423BINDING SITE FOR RESIDUE NA 0 9160
215OC8SOFTWAREU 0:837 , HOH 0:5162 , HOH 0:5660 , HOH 0:7329 , GLN B:230 , GLY B:231BINDING SITE FOR RESIDUE NA 0 9161
216OC9SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277BINDING SITE FOR RESIDUE NA 0 9162
217PC1SOFTWAREU 0:1359 , C 0:1360 , HOH 0:4081 , HOH 0:7544BINDING SITE FOR RESIDUE NA 0 9163
218PC2SOFTWAREC 0:2056 , U 0:2057 , HOH 0:3430BINDING SITE FOR RESIDUE NA 0 9164
219PC3SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , ALA M:194BINDING SITE FOR RESIDUE NA 0 9165
220PC4SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3501 , HOH 0:4415 , HOH 0:4475BINDING SITE FOR RESIDUE NA 0 9166
221PC5SOFTWAREG 0:464 , G 0:475 , HOH 0:3443 , HOH 0:5055 , ARG C:55BINDING SITE FOR RESIDUE NA 0 9167
222PC6SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 0 9168
223PC7SOFTWAREU 0:1831 , G 0:1832 , A 0:2022 , HOH 0:4371 , HOH 0:9729BINDING SITE FOR RESIDUE NA 0 9170
224PC8SOFTWAREG 0:2491 , U 0:2492 , U 0:2528 , G 0:2529 , HOH 0:3248BINDING SITE FOR RESIDUE NA 0 9171
225PC9SOFTWAREU 0:919 , G 0:921 , G 0:924BINDING SITE FOR RESIDUE NA 0 9172
226QC1SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , HOH 0:7782BINDING SITE FOR RESIDUE NA 0 9173
227QC2SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416 , HOH 0:3512BINDING SITE FOR RESIDUE NA 0 9174
228QC3SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9889BINDING SITE FOR RESIDUE NA 0 9175
229QC4SOFTWAREG 0:911 , U 0:1293 , G 0:1295 , HOH 0:6866BINDING SITE FOR RESIDUE NA 0 9177
230QC5SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3814 , HIS L:18 , HOH L:9426 , HOH L:9447BINDING SITE FOR RESIDUE NA 0 9178
231QC6SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:4311 , HOH 0:5573BINDING SITE FOR RESIDUE NA 0 9179
232QC7SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4288 , HOH 0:9955BINDING SITE FOR RESIDUE NA 0 9181
233QC8SOFTWAREG 0:2772 , G 0:2773BINDING SITE FOR RESIDUE NA 0 9182
234QC9SOFTWAREC 0:197 , HOH 0:5811BINDING SITE FOR RESIDUE NA 0 9184
235RC1SOFTWAREA 0:1079 , HOH 0:5754 , HOH 0:8222BINDING SITE FOR RESIDUE NA 0 9185
236RC2SOFTWAREG 0:1452 , G 0:1676BINDING SITE FOR RESIDUE CL 0 9303
237RC3SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 0 9305
238RC4SOFTWAREC 0:2388 , HOH 0:3769 , PHE Q:52 , HIS Q:53 , PHE Q:56BINDING SITE FOR RESIDUE CL 0 9311
239RC5SOFTWAREG 0:2582 , A 0:2596 , HOH 0:5658 , LYS K:14 , SER K:33BINDING SITE FOR RESIDUE CL 0 9312
240RC6SOFTWAREG 0:1299 , G 0:1300 , A 0:1328 , A 0:1329 , HOH 0:5228 , HOH 0:5517BINDING SITE FOR RESIDUE CL 0 9313
241RC7SOFTWAREG 0:644 , HIS L:13 , HOH L:9489BINDING SITE FOR RESIDUE CL 0 9314
242RC8SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 9315
243RC9SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 9316
244SC1SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:9355BINDING SITE FOR RESIDUE CL 0 9317
245SC2SOFTWAREG 0:1072 , G 0:1087 , A 0:1291BINDING SITE FOR RESIDUE CL 0 9322
246SC3SOFTWAREG 0:824 , G 0:854 , HOH 0:4552 , HOH 0:4874 , HOH 0:5104BINDING SITE FOR RESIDUE SR 0 9405
247SC4SOFTWAREG 0:836 , U 0:2615 , HOH 0:4433 , HOH 0:9896 , HOH 0:9987 , GLN B:230BINDING SITE FOR RESIDUE SR 0 9406
248SC5SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3024 , HOH 0:4232 , HOH 0:4550BINDING SITE FOR RESIDUE SR 0 9407
249SC6SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:3960 , HOH 0:8300 , HOH 0:9635 , HOH 0:9727BINDING SITE FOR RESIDUE SR 0 9408
250SC7SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:3058 , HOH 0:7098 , HOH 0:8445BINDING SITE FOR RESIDUE SR 0 9410
251SC8SOFTWAREA 0:1754 , A 0:1755 , HOH 0:7106 , HOH 0:7660 , HOH 0:8136BINDING SITE FOR RESIDUE SR 0 9411
252SC9SOFTWAREC 0:893 , HOH 0:6181 , HOH 0:8444 , HOH C:9148BINDING SITE FOR RESIDUE SR 0 9412
253TC1SOFTWAREG 0:1055 , HOH 0:4421 , HOH 0:4644 , HOH 0:5398 , HOH 0:6855 , ASP H:10BINDING SITE FOR RESIDUE SR 0 9413
254TC2SOFTWAREU 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:9440BINDING SITE FOR RESIDUE SR 0 9414
255TC3SOFTWAREHOH 0:4363 , HOH 0:6062 , HOH 0:6689 , HOH 0:7110 , HOH 0:8381 , HOH 0:8382BINDING SITE FOR RESIDUE SR 0 9415
256TC4SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3299 , HOH 0:4409BINDING SITE FOR RESIDUE SR 0 9416
257TC5SOFTWAREC 0:85 , A 0:86 , C 0:87 , HOH 0:5910 , ASP T:68BINDING SITE FOR RESIDUE SR 0 9417
258TC6SOFTWAREHOH 0:4740 , HOH 0:5447 , HOH 0:5779BINDING SITE FOR RESIDUE SR 0 9420
259TC7SOFTWAREU 0:664 , G 0:681 , HOH C:9143BINDING SITE FOR RESIDUE SR 0 9421
260TC8SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4689 , HOH 0:5995 , HOH 0:6322BINDING SITE FOR RESIDUE SR 0 9422
261TC9SOFTWAREU 0:454 , C 0:478 , HOH 0:4807 , HOH 0:6201 , HOH 0:6682 , NA 0:9160BINDING SITE FOR RESIDUE SR 0 9423
262UC1SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:8313 , HOH 0:8314BINDING SITE FOR RESIDUE SR 0 9424
263UC2SOFTWAREG 0:2543 , C 0:2608 , C 4:74 , HOH 4:7915BINDING SITE FOR RESIDUE SR 0 9425
264UC3SOFTWAREG 0:2632 , HOH 0:5117 , HOH 0:6036BINDING SITE FOR RESIDUE SR 0 9426
265UC4SOFTWAREA 0:1717 , G 0:1718 , HOH 0:5125 , HOH 0:5898 , HOH 0:6907BINDING SITE FOR RESIDUE SR 0 9427
266UC5SOFTWAREG 0:471 , HOH 0:3649 , HOH 0:4978 , HOH 0:6171 , HOH 0:7975 , HOH 0:9829 , HOH 0:9868BINDING SITE FOR RESIDUE SR 0 9428
267UC6SOFTWAREG 0:1059 , C 0:1127 , HOH 0:4417 , HOH 0:5438 , HOH 0:5873 , HOH 0:9741BINDING SITE FOR RESIDUE SR 0 9429
268UC7SOFTWAREA 0:639 , G 0:640 , HOH 0:3251 , HOH 0:3517 , HOH 0:4578 , HOH 0:5391 , HOH 0:5826 , HOH 0:6586BINDING SITE FOR RESIDUE SR 0 9430
269UC8SOFTWAREG 0:2725 , G 0:2755 , HOH 0:3875 , HOH 0:4408 , HOH 0:6864 , HOH 0:7187BINDING SITE FOR RESIDUE SR 0 9431
270UC9SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 9432
271VC1SOFTWAREHOH 0:3944 , HOH 0:6333 , HOH 0:6969BINDING SITE FOR RESIDUE SR 0 9433
272VC2SOFTWAREA 0:2553 , HOH 0:3211 , HOH 0:4247BINDING SITE FOR RESIDUE SR 0 9434
273VC3SOFTWAREU 0:1109 , G 0:1110 , A 0:1247 , HOH 0:4057 , HOH 0:7476BINDING SITE FOR RESIDUE SR 0 9435
274VC4SOFTWAREG 0:1543 , HOH 0:5552 , HOH 0:6621 , HOH 0:6633BINDING SITE FOR RESIDUE SR 0 9438
275VC5SOFTWAREA 0:532 , U 0:533 , HOH 0:4329 , HOH 0:4568 , HOH 0:8376 , HOH 0:8377BINDING SITE FOR RESIDUE SR 0 9440
276VC6SOFTWAREU 0:777 , U 0:864 , HOH 0:3247 , HOH 0:3881 , HOH 0:4270 , HOH 0:4274 , HOH 0:7943 , MG 0:8031 , NA 0:9125BINDING SITE FOR RESIDUE SR 0 9441
277VC7SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8404 , HOH 0:8405BINDING SITE FOR RESIDUE SR 0 9442
278VC8SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3826 , HOH 0:4214 , HOH 0:7933 , HOH 0:8386BINDING SITE FOR RESIDUE SR 0 9443
279VC9SOFTWAREC 0:880 , A 0:882 , U 0:883 , HOH 0:4223 , HOH 0:8371 , HOH 0:8372 , HOH 0:9867BINDING SITE FOR RESIDUE SR 0 9444
280WC1SOFTWAREHOH 0:4877 , HOH 0:7017 , HOH 0:8011BINDING SITE FOR RESIDUE SR 0 9445
281WC2SOFTWAREHOH 0:5582 , HOH 0:5741 , HOH 0:6674BINDING SITE FOR RESIDUE SR 0 9446
282WC3SOFTWAREG 0:84 , C 0:85 , HOH 0:5910 , ASP T:68 , HOH T:4745BINDING SITE FOR RESIDUE SR 0 9447
283WC4SOFTWAREA 0:2465 , G 0:2466 , HOH 0:8441 , HOH 0:9686 , ASP L:36 , HOH L:9433BINDING SITE FOR RESIDUE SR 0 9448
284WC5SOFTWAREG 0:1683 , U 0:1696 , HOH 0:3400 , HOH 0:5330 , HOH 0:5409BINDING SITE FOR RESIDUE SR 0 9449
285WC6SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:6425 , HOH 0:6793 , HOH 0:8438BINDING SITE FOR RESIDUE SR 0 9450
286WC7SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6657 , HOH 0:7858BINDING SITE FOR RESIDUE SR 0 9451
287WC8SOFTWAREU 0:2016 , HOH 0:7861 , HOH 0:8111BINDING SITE FOR RESIDUE SR 0 9452
288WC9SOFTWAREG 0:1484 , HOH 0:4313 , HOH 0:8336 , HOH 0:8392 , HOH 0:8393BINDING SITE FOR RESIDUE SR 0 9453
289XC1SOFTWAREG 0:2091 , HOH 0:6642 , HOH 0:7196BINDING SITE FOR RESIDUE SR 0 9454
290XC2SOFTWAREC 0:1690 , HOH 0:3073 , HOH 0:4340 , HOH 0:4639 , HOH 0:5279BINDING SITE FOR RESIDUE SR 0 9455
291XC3SOFTWAREA 0:2302 , A 0:2303 , HOH 0:4242 , HOH 0:4366 , HOH 0:5435BINDING SITE FOR RESIDUE SR 0 9456
292XC4SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , HOH 0:3422 , HOH 0:4218 , HOH 0:4350BINDING SITE FOR RESIDUE SR 0 9457
293XC5SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 9459
294XC6SOFTWAREU 0:391 , HOH 0:3634 , HOH 0:5994 , ARG 3:42 , NA 3:9169BINDING SITE FOR RESIDUE SR 0 9461
295XC7SOFTWAREG 0:2810 , HOH 0:4636 , HOH 0:8145 , ASN B:27BINDING SITE FOR RESIDUE SR 0 9462
296XC8SOFTWAREU 0:2557 , HOH 0:3665 , HOH 0:7177BINDING SITE FOR RESIDUE SR 0 9464
297XC9SOFTWAREA 0:682 , G 0:683 , HOH 0:8435 , HOH 0:8447BINDING SITE FOR RESIDUE SR 0 9465
298YC1SOFTWAREC 0:1462 , A 0:1463 , GLY 1:40BINDING SITE FOR RESIDUE SR 0 9466
299YC2SOFTWAREA 0:1133 , G 0:1134 , HOH 0:4950 , HOH 0:5365BINDING SITE FOR RESIDUE SR 0 9467
300YC3SOFTWAREU 0:1972 , HOH 0:3292 , HOH 0:3907BINDING SITE FOR RESIDUE SR 0 9468
301YC4SOFTWAREG 0:1113 , HOH 0:4292 , HOH 0:4302BINDING SITE FOR RESIDUE SR 0 9469
302YC5SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4043 , HOH 0:4192 , HOH 0:5239 , NA 0:9108BINDING SITE FOR RESIDUE SR 0 9473
303YC6SOFTWAREG 0:2284 , HOH 0:6074 , HOH 0:7696 , HOH 0:8249BINDING SITE FOR RESIDUE SR 0 9474
304YC7SOFTWAREG 0:2777 , HOH 0:4786 , HOH 0:7838BINDING SITE FOR RESIDUE SR 0 9475
305YC8SOFTWAREA 0:1815 , HOH 0:7892 , HOH 0:8365 , HOH 0:8366BINDING SITE FOR RESIDUE SR 0 9477
306YC9SOFTWAREC 0:235 , HOH 0:5274 , HOH 0:6005 , HOH 0:6690 , HOH 0:8081BINDING SITE FOR RESIDUE SR 0 9478
307ZC1SOFTWAREU 0:2690 , HOH 0:3661 , HOH 0:6092BINDING SITE FOR RESIDUE SR 0 9480
308ZC2SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5443 , GLY L:14 , HOH L:9490BINDING SITE FOR RESIDUE SR 0 9482
309ZC3SOFTWAREA 0:565 , G 0:592 , HOH 0:5777BINDING SITE FOR RESIDUE SR 0 9483
310ZC4SOFTWAREHOH 0:6145BINDING SITE FOR RESIDUE SR 0 9484
311ZC5SOFTWAREHOH 0:6973 , HOH 0:7783 , HOH 0:7927BINDING SITE FOR RESIDUE SR 0 9488
312ZC6SOFTWAREU 0:1835 , HOH 0:3587BINDING SITE FOR RESIDUE SR 0 9489
313ZC7SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939 , HOH 0:8442BINDING SITE FOR RESIDUE SR 0 9490
314ZC8SOFTWAREHOH 0:6075BINDING SITE FOR RESIDUE SR 0 9495
315ZC9SOFTWAREC 0:1129 , HOH 0:4224 , HOH 0:6637 , HOH 0:7427 , HOH 0:8416 , C 9:3091 , G 9:3092BINDING SITE FOR RESIDUE SR 0 9498

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VQM)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:111-127
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:126-140
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1VQM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1vqm 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1vqm11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1vqm100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1vqm101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1vqm 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1vqm21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1vqm200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1vqm201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1vqm 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1vqm31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1vqm300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1vqm 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 4 from PDB  Type:DNA/RNA  Length:7
                                        
                1vqm 4   74 CCaxACC  181
                              ||   
                             76-PPU
                             178-PO2

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1vqm 9 3001 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC 3122
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100      3110      3120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1vqma2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1vqma1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1vqmA01 A:1-78 Nucleic acid-binding proteins                                  ---1vqmA02 A:82-159  [code=2.30.30.30, no name defined]                          1vqmA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1vqmA02 A:10-82                                             -----Ribosomal_L2_C-1vqmA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeeee.........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1vqmb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1vqmB01 B:1-38,B:207-257              1vqmB02 B:39-77,B:189-206,B:258-337    1vqmB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1vqmB02           1vqmB01 B:1-38,B:207-257                           1vqmB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1vqmB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeee.......hhhhh.......hhhhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee.....eehhhhhhh....hhhhhh.........................ee....eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1vqmc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1vqmC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1vqmC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqm C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1vqmd1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1vqmD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1vqmD0     1 D:11-64                     ---Ribosomal_L5_C-1vqmD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhh....eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee...hhhhh........hhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1vqme1 E:1-79 Ribosomal protein L6                                            d1vqme2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1vqmE01 E:1-79  [code=3.90.930.12, no name defined]                            1vqmE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqmE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqmE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1vqmf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1vqmF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1vqmF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhh....eeee....hhhhh.hhhhhhhh....eeee.hhhhhhhhh.......eee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1vqmg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1vqm G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1vqmh1 H:1-163 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1vqmH00 H:1-171  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee....hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhhhhh...eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm H    1 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA  171
                                    10        20        30        40        50        60        70        80        90        |-         -|      120       130       140       150       160       170 
                                                                                                                             99         111                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1vqmi1 I:71-140 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1vqmI00 I:71-140  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1vqmI01 I:71-139                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhhh.............eeeehhhhhhhhhhh.......hhhhhhhhhh.......eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1vqm I   71 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  140
                                    80        90       100       110       120       130       140

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1vqmj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1vqmJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1vqmJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee..................hhhhh..eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1vqmk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1vqmK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1vqmK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqm K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1vqml1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1vqmL01 L:1-50                                    1vqmL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1vqmL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author .hhhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqm L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1vqmm1 M:1-194 Ribosomal protein L15e                                                                                                                                                             SCOP domains
               CATH domains 1vqmM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1vqmM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhh.......eeeeeeeee.............hhhhhh........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1vqmn1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1vqmN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1vqmN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqm N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1vqmo1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1vqmO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1vqmO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1vqmp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1vqmP01 P:1-55  [code=1.10.1650.10, no name defined]   1vqmP02 P:56-88 Single Heli x bin1vqmP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1vqmq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1vqmQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1vqmQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhhh......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1vqm Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1vqmr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1vqmR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1vqmR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ............eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqm R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1vqms1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1vqmS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1vqmS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1vqm S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1vqmt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1vqmT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1vqmT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1vqmu1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1vqmU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1vqmU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1vqm U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1vqmv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1vqmV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1vqmV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1vqm V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1vqmw1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1vqmW01 W:1-57,W:114-154                                 1vqmW02 W:58-113  [code=1.10.15.30, no name defined]    1vqmW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1vqmW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhh.....hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1vqmx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1vqmX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1vqmX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1vqm X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1vqmy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1vqmY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh.......hhhhh............................hhhhh.............eeeee..hhhhh......eeeee....hhhhhhhhhhhhhh...ee....eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqm Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1vqmz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1vqmZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1vqmZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh.....hhhhhhhhhhhhhhh...........eeeee..eeee....eeee.......hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1vqm Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric/Biological Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.