Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF THE TRANSITION STATE ANALOGUE "DCSN" BOUND TO THE LARGE RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  T. M. Schmeing, T. A. Steitz
Date :  16 Dec 04  (Deposition) - 29 Nov 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,4,9
Keywords :  Ribosome 50S, Protein-Protein Complex, Rna-Rna Complex, Protein-Rna Complex, Peptidyl Transferase Reaction, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. M. Schmeing, K. S. Huang, D. E. Kitchen, S. A. Strobel, T. A. Steitz
Structural Insights Into The Roles Of Water And The 2' Hydroxyl Of The P Site Trna In The Peptidyl Transferase Reaction.
Mol. Cell V. 20 437 2005
PubMed-ID: 16285925  |  Reference-DOI: 10.1016/J.MOLCEL.2005.09.006

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 3 - 5'-R(*CP*CP*(PPU)*(TSE)*(DA)*CP*C)-3'
    Chains4
    EngineeredYES
    Other DetailsSYNTHETIC OLIGO C-C-PUROMYCIN- P=S-(CH2-CO2)-DA-C-C
    SyntheticYES
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L4E
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 32 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526272829303132
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ012349

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (15, 322)

Asymmetric/Biological Unit (15, 322)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2C2Ligand/IonCYTIDINE-5'-MONOPHOSPHATE
3CD5Ligand/IonCADMIUM ION
4CL22Ligand/IonCHLORIDE ION
5DA1Ligand/Ion2'-DEOXYADENOSINE-5'-MONOPHOSPHATE
6K2Ligand/IonPOTASSIUM ION
7MG94Ligand/IonMAGNESIUM ION
8NA75Ligand/IonSODIUM ION
9OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
10OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
11PPU1Mod. NucleotidePUROMYCIN-5'-MONOPHOSPHATE
12PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
13SR114Ligand/IonSTRONTIUM ION
14TSE1Mod. NucleotideTHIOPHOSPHONOACETIC ACID
15UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (313, 313)

Asymmetric Unit (313, 313)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2284 , A 0:2474 , A 0:2485 , A 0:2486 , A 0:2637 , MG 0:8118 , HOH 0:8450 , PPU 4:76 , TSE 4:178 , C 4:180 , HOH 4:7912 , HOH 4:7915 , HOH 4:7923BINDING SITE FOR RESIDUE DA 4 179
002AC2SOFTWAREC 0:2104 , C 0:2105 , G 0:2284 , G 0:2285 , C 0:2636 , A 0:2637 , MG 0:8118 , DA 4:179 , C 4:181 , HOH 4:7912 , HOH 4:7915 , HOH 4:7921 , HOH 4:7923BINDING SITE FOR RESIDUE C 4 180
003AC3SOFTWAREG 0:2285 , G 0:2286 , C 0:2636 , C 4:180 , HOH 4:7013BINDING SITE FOR RESIDUE C 4 181
004AC4SOFTWAREG 0:2482 , A 0:2483 , A 0:2532 , C 0:2533 , C 0:2534 , HOH 0:4208 , HOH 0:8309 , HOH 0:9800BINDING SITE FOR RESIDUE MG 0 8001
005AC5SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , U 0:2535 , HOH 0:8288 , HOH 0:8289 , HOH 0:9884BINDING SITE FOR RESIDUE MG 0 8002
006AC6SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:4257 , HOH A:9500 , HOH A:9524BINDING SITE FOR RESIDUE MG 0 8003
007AC7SOFTWAREG 0:456 , A 0:459 , HOH 0:3390 , HOH 0:4370 , HOH 0:8294 , HOH 0:9672BINDING SITE FOR RESIDUE MG 0 8004
008AC8SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4205 , HOH 0:8310 , HOH 0:8311BINDING SITE FOR RESIDUE MG 0 8005
009AC9SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:4222 , HOH 0:8303 , HOH 0:8383BINDING SITE FOR RESIDUE MG 0 8008
010AD1SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939 , HOH 0:8442BINDING SITE FOR RESIDUE SR 0 9490
011AD2SOFTWAREHOH 0:6076BINDING SITE FOR RESIDUE SR 0 9495
012AD3SOFTWAREC 0:1129 , HOH 0:4216 , HOH 0:6636 , HOH 0:7420 , HOH 0:8416 , C 9:3091 , G 9:3092 , HOH 9:3843BINDING SITE FOR RESIDUE SR 0 9498
013AD4SOFTWAREHOH 0:6381BINDING SITE FOR RESIDUE SR 0 9501
014AD5SOFTWAREG 0:1290 , A 0:1291 , HOH 0:5526 , HOH 0:8385BINDING SITE FOR RESIDUE SR 0 9504
015AD6SOFTWAREA 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 0 9505
016AD7SOFTWAREA 0:632 , C 0:633 , A 0:2538 , U 0:2539 , HOH 0:4238 , HOH 0:5422 , HOH 0:8446BINDING SITE FOR RESIDUE SR 0 9506
017AD8SOFTWAREG 0:911 , G 0:1292 , HOH 0:3418 , HOH 0:3661BINDING SITE FOR RESIDUE SR 0 9508
018AD9SOFTWAREA 0:378 , G 0:379 , A 0:429 , HOH 0:5135 , HOH 0:7946BINDING SITE FOR RESIDUE SR 0 9509
019BC1SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4327 , HOH 0:7892 , HOH 0:8304 , NA 0:9158 , HOH 0:9956BINDING SITE FOR RESIDUE MG 0 8009
020BC2SOFTWAREG 0:28 , HOH 0:3256 , HOH 0:3827 , HOH 0:4239 , HOH 0:8384 , HOH 0:9664BINDING SITE FOR RESIDUE MG 0 8012
021BC3SOFTWAREG 0:877 , G 0:2623 , A 0:2624 , HOH 0:4234 , HOH A:9524 , HOH A:9621BINDING SITE FOR RESIDUE MG 0 8013
022BC4SOFTWAREA 0:2101 , G 0:2102 , A 0:2103 , G 0:2537 , HOH 0:4250BINDING SITE FOR RESIDUE MG 0 8014
023BC5SOFTWAREA 0:844 , A 0:1689 , HOH 0:4214 , HOH 0:8318 , HOH 0:9633 , HOH 0:9650BINDING SITE FOR RESIDUE MG 0 8015
024BC6SOFTWAREG 0:456 , HOH 0:3040 , HOH 0:8295 , GLY C:86 , HOH C:9556 , HOH C:9560 , HOH C:9664BINDING SITE FOR RESIDUE MG 0 8017
025BC7SOFTWAREA 0:2011 , HOH 0:4734 , HOH 0:7717 , HOH 0:8314 , HOH 0:8315 , HOH 0:8316BINDING SITE FOR RESIDUE MG 0 8019
026BC8SOFTWAREC 0:1830 , HOH 0:8298 , HOH 0:8317 , HOH 0:9747 , HOH 0:9750 , HOH 0:9821BINDING SITE FOR RESIDUE MG 0 8020
027BC9SOFTWAREG 0:2304 , HOH 0:3570 , HOH 0:4230 , HOH 0:4231 , HOH 0:8301 , HOH 0:8302BINDING SITE FOR RESIDUE MG 0 8021
028BD1SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 0 9515
029BD2SOFTWAREC 0:1103 , HOH 0:3165 , GLU J:28BINDING SITE FOR RESIDUE SR 0 9517
030BD3SOFTWAREC 0:2672 , ARG B:25 , GLU B:163 , ARG B:310BINDING SITE FOR RESIDUE SR 0 9521
031BD4SOFTWAREG 0:2700BINDING SITE FOR RESIDUE SR 0 9522
032BD5SOFTWAREA 0:2622 , G 0:2623 , HOH 0:5202 , HOH 0:6421 , HOH 0:7694BINDING SITE FOR RESIDUE SR 0 9529
033BD6SOFTWAREG 0:2617 , G 0:2618 , UR3 0:2619 , HOH 0:4220 , HOH 0:4405 , HOH 0:8320BINDING SITE FOR RESIDUE SR 0 9530
034BD7SOFTWAREA 0:1427 , HOH 0:8283BINDING SITE FOR RESIDUE SR 0 9532
035BD8SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3210 , HOH 0:4340 , HOH 0:4348BINDING SITE FOR RESIDUE SR 0 9534
036BD9SOFTWAREA 0:846 , G 0:1694 , G 0:1695BINDING SITE FOR RESIDUE SR 0 9539
037CC1SOFTWAREG 0:2097 , U 0:2539 , G 0:2540 , HOH 0:4314 , HOH 0:5286 , HOH 0:9736 , HOH 0:9785BINDING SITE FOR RESIDUE MG 0 8022
038CC2SOFTWAREA 0:1381 , HOH X:1192BINDING SITE FOR RESIDUE MG 0 8024
039CC3SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4752 , HOH 0:8321BINDING SITE FOR RESIDUE MG 0 8025
040CC4SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:3018 , HOH 0:8322 , HOH 0:8323BINDING SITE FOR RESIDUE MG 0 8026
041CC5SOFTWAREC 0:240 , G 0:269 , HOH 0:4458 , HOH 0:4599 , HOH 0:4739 , HOH 0:8389BINDING SITE FOR RESIDUE MG 0 8027
042CC6SOFTWAREA 0:1448 , U 0:1677 , HOH 0:4269 , HOH 0:4290 , HOH 0:4301 , HOH 0:8326BINDING SITE FOR RESIDUE MG 0 8028
043CC7SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:8328 , HOH 0:8330BINDING SITE FOR RESIDUE MG 0 8029
044CC8SOFTWAREU 0:1748 , U 0:1749 , HOH 0:4232 , HOH 0:8296 , HOH 0:8297 , HOH 0:8307BINDING SITE FOR RESIDUE MG 0 8030
045CC9SOFTWAREU 0:777 , C 0:778 , HOH 0:3876 , HOH 0:8332 , SR 0:9441 , HOH 1:9515BINDING SITE FOR RESIDUE MG 0 8031
046CD1SOFTWAREG 0:2609 , U 0:2610 , HOH 0:3898 , HOH 0:4311 , HOH 0:6159 , HOH B:9588BINDING SITE FOR RESIDUE SR 0 9545
047CD2SOFTWAREA 0:1411 , A 0:1682 , HOH 0:6120 , HOH 0:7580BINDING SITE FOR RESIDUE SR 0 9547
048CD3SOFTWAREHOH 0:6277BINDING SITE FOR RESIDUE SR 0 9560
049CD4SOFTWAREG 0:834 , U 0:835 , C 0:2644 , HOH 0:3981 , HOH 0:4494 , HOH 0:5041 , HOH 0:6660BINDING SITE FOR RESIDUE SR 0 9566
050CD5SOFTWAREU 0:2461 , HOH 0:6771 , ASP 3:59BINDING SITE FOR RESIDUE SR 0 9568
051CD6SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9570
052CD7SOFTWAREU 0:1996 , U 0:2589 , U 0:2590 , C 0:2591 , HOH 0:6153 , HOH 0:6467BINDING SITE FOR RESIDUE SR 0 9581
053CD8SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9585
054CD9SOFTWAREG 0:2102 , A 0:2103 , HOH 0:3128BINDING SITE FOR RESIDUE SR 0 9590
055DC1SOFTWAREU 0:2115 , G 0:2272 , HOH 0:3595 , HOH 0:4376 , HOH 0:4773 , HOH 0:8333 , ALA A:196 , HOH A:9542BINDING SITE FOR RESIDUE MG 0 8032
056DC2SOFTWAREG 0:956 , HOH 0:4261 , HOH 0:8337 , HOH 0:8338 , HOH 0:8339 , HOH 0:9989BINDING SITE FOR RESIDUE MG 0 8036
057DC3SOFTWAREA 0:2553 , HOH 0:3736 , HOH 0:3811 , HOH 0:4240 , HOH 0:8393 , HOH 0:9703BINDING SITE FOR RESIDUE MG 0 8037
058DC4SOFTWAREHOH 0:4218 , HOH 0:4241 , HOH 0:4262 , HOH 0:4264 , HOH 0:8341 , HOH 0:9906BINDING SITE FOR RESIDUE MG 0 8038
059DC5SOFTWAREU 0:115 , G 0:118 , HOH 0:3523 , HOH 0:4550 , HOH 0:5663 , HOH 0:8342BINDING SITE FOR RESIDUE MG 0 8039
060DC6SOFTWAREU 0:172 , U 0:392 , HOH 0:8394 , HOH M:9338BINDING SITE FOR RESIDUE MG 0 8040
061DC7SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:4691 , HOH 0:4784BINDING SITE FOR RESIDUE MG 0 8041
062DC8SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3061 , HOH 0:4249 , HOH 0:4991 , HOH 0:8344BINDING SITE FOR RESIDUE MG 0 8042
063DC9SOFTWAREG 0:816 , G 0:817 , HOH 0:3425 , HOH 0:7881 , MG 0:8106 , HOH 0:8396BINDING SITE FOR RESIDUE MG 0 8043
064DD1SOFTWAREG 0:2639BINDING SITE FOR RESIDUE SR 0 9601
065DD2SOFTWAREG 0:1376 , A 0:1693 , HOH 0:5053BINDING SITE FOR RESIDUE SR 0 9626
066DD3SOFTWAREU 0:1368 , HOH 0:5439 , HOH 0:6394 , HOH R:9467 , HOH R:9468BINDING SITE FOR RESIDUE SR 0 9629
067DD4SOFTWAREA 9:3056 , A 9:3057 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8095
068DD5SOFTWAREG 9:3021 , G 9:3022 , U 9:3055 , A 9:3057 , G 9:3058BINDING SITE FOR RESIDUE NA 9 9183
069DD6SOFTWAREHOH 0:5561 , C 9:3091 , HOH H:9526BINDING SITE FOR RESIDUE SR 9 9481
070DD7SOFTWAREG 9:3078 , G 9:3102BINDING SITE FOR RESIDUE SR 9 9503
071DD8SOFTWAREHOH 9:120 , A 9:3044 , HOH 9:4351BINDING SITE FOR RESIDUE SR 9 9588
072DD9SOFTWAREG 0:1873 , HOH 0:4924 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120BINDING SITE FOR RESIDUE MG A 8066
073EC1SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3894 , GLY R:65 , HOH R:9505BINDING SITE FOR RESIDUE MG 0 8044
074EC2SOFTWAREG 0:1979 , HOH 0:8345 , HOH 0:8397 , HOH 0:8399BINDING SITE FOR RESIDUE MG 0 8045
075EC3SOFTWAREG 0:1794 , HOH 0:7773 , HOH 0:8400 , HOH 0:8401BINDING SITE FOR RESIDUE MG 0 8046
076EC4SOFTWAREHOH 0:5067 , HOH 0:7554 , HOH 0:8414BINDING SITE FOR RESIDUE MG 0 8047
077EC5SOFTWAREC 0:2248BINDING SITE FOR RESIDUE MG 0 8050
078EC6SOFTWAREG 0:641 , A 0:1355 , HOH 0:4687 , HOH 0:8346 , HOH 0:8347BINDING SITE FOR RESIDUE MG 0 8051
079EC7SOFTWAREU 0:1125 , HOH 0:8416BINDING SITE FOR RESIDUE MG 0 8052
080EC8SOFTWAREC 0:162 , U 0:2276 , HOH 0:3057 , HOH 0:8300 , HOH 0:8348 , HOH 0:8349BINDING SITE FOR RESIDUE MG 0 8054
081EC9SOFTWAREC 0:2720 , HOH 0:6938 , GLY B:337 , HOH B:9488 , HOH B:9593 , HOH B:9594BINDING SITE FOR RESIDUE MG 0 8055
082ED1SOFTWAREHOH 0:6915 , LYS A:178BINDING SITE FOR RESIDUE CL A 9309
083ED2SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9549 , HOH A:9590BINDING SITE FOR RESIDUE SR A 9436
084ED3SOFTWAREHOH 0:4924 , HOH 0:6476 , HOH 0:8432 , ASP A:26 , GLU A:28BINDING SITE FOR RESIDUE SR A 9437
085ED4SOFTWAREGLU A:28BINDING SITE FOR RESIDUE SR A 9497
086ED5SOFTWAREHOH 0:3203 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 9319
087ED6SOFTWAREHOH 0:3846 , ASN B:243 , SER B:245 , HOH B:9476BINDING SITE FOR RESIDUE SR B 9458
088ED7SOFTWAREASP C:45 , THR C:94 , LYS C:96 , HOH C:9506BINDING SITE FOR RESIDUE NA C 9104
089ED8SOFTWAREC 0:34 , U 0:457 , HOH 0:4611 , ASP C:49 , ARG C:55BINDING SITE FOR RESIDUE SR C 9500
090ED9SOFTWAREARG D:51BINDING SITE FOR RESIDUE NA D 9151
091FC1SOFTWAREA 0:2757 , HOH 0:4259 , HOH 0:8367 , ASN B:335 , HOH B:9478BINDING SITE FOR RESIDUE MG 0 8056
092FC2SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5574 , HOH 0:8351 , GLN A:207 , HOH A:9624BINDING SITE FOR RESIDUE MG 0 8057
093FC3SOFTWAREG 0:1884 , HOH 0:3009 , HOH 0:4351 , HOH 0:8351 , HOH A:9527BINDING SITE FOR RESIDUE MG 0 8058
094FC4SOFTWAREG 0:2618 , HOH 0:4312 , HOH 0:4473 , MG 0:8085 , HOH 0:8308 , HOH 0:9663 , HOH 0:9667BINDING SITE FOR RESIDUE MG 0 8059
095FC5SOFTWAREG 0:175 , U 0:224 , HOH 0:8354 , HOH 0:8355 , HOH 0:9794BINDING SITE FOR RESIDUE MG 0 8060
096FC6SOFTWAREA 0:1369 , U 0:2650 , HOH 0:8356 , HOH 0:8357BINDING SITE FOR RESIDUE MG 0 8061
097FC7SOFTWAREHOH 0:4764 , HOH 0:5594 , HOH 0:7504 , HOH 0:7899 , HOH 0:8293 , HOH 0:8366BINDING SITE FOR RESIDUE MG 0 8063
098FC8SOFTWAREG 0:782 , C 0:783 , HOH 0:4554 , HOH A:9512 , HOH A:9591 , HOH A:9623BINDING SITE FOR RESIDUE MG 0 8065
099FC9SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8360 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8067
100FD1SOFTWAREHOH 0:5667BINDING SITE FOR RESIDUE SR F 9595
101FD2SOFTWAREA 0:1133 , G 0:1134 , TYR H:154 , ILE H:157 , THR H:158 , PRO H:159BINDING SITE FOR RESIDUE SR H 9486
102FD3SOFTWAREHOH 0:3107 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69 , HOH J:4949BINDING SITE FOR RESIDUE NA J 9146
103FD4SOFTWAREILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 9301
104FD5SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 9302
105FD6SOFTWAREGLY J:64 , ASN J:65 , TYR J:69BINDING SITE FOR RESIDUE CL J 9321
106FD7SOFTWAREHOH 0:4019 , HOH 0:4820 , HOH 0:6581 , ASN K:42 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8069
107FD8SOFTWARELYS L:52 , ARG L:53BINDING SITE FOR RESIDUE CL L 9310
108FD9SOFTWAREHOH 0:4247 , HOH 0:9903 , ARG L:27 , GLU L:39 , HOH L:9434 , HOH L:9489BINDING SITE FOR RESIDUE SR L 9409
109GC1SOFTWAREA 0:2569 , HOH 0:4339 , HOH 0:5386 , HOH 0:7182 , HOH E:920BINDING SITE FOR RESIDUE MG 0 8068
110GC2SOFTWAREA 0:166 , G 0:219 , HOH 0:4401 , HOH 0:5522 , HOH 0:6149 , HOH 0:9748BINDING SITE FOR RESIDUE MG 0 8070
111GC3SOFTWAREU 0:954 , C 0:2298 , HOH 0:4581 , HOH 0:8419BINDING SITE FOR RESIDUE MG 0 8072
112GC4SOFTWAREA 0:1286 , A 0:1287 , HOH 0:8361 , HOH W:7803 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8074
113GC5SOFTWAREA 0:907 , A 0:908 , HOH 0:4229 , HOH 0:4501 , HOH 0:5501 , HOH 0:8362BINDING SITE FOR RESIDUE MG 0 8075
114GC6SOFTWAREHOH 0:7354 , HOH 0:8368 , HOH 0:8369 , HOH 0:8420 , HOH 0:8421BINDING SITE FOR RESIDUE MG 0 8076
115GC7SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:4204 , HOH 0:4209 , HOH 0:4221BINDING SITE FOR RESIDUE MG 0 8079
116GC8SOFTWAREA 0:1684 , G 0:1723 , U 0:1724 , HOH 0:4788 , HOH 0:7191 , HOH 0:8372 , HOH 0:8424BINDING SITE FOR RESIDUE MG 0 8080
117GC9SOFTWAREA 0:1437 , HOH 0:5805 , HOH 0:8433 , HOH 0:8434BINDING SITE FOR RESIDUE MG 0 8082
118GD1SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:9430BINDING SITE FOR RESIDUE NA M 9147
119GD2SOFTWARESER M:106 , ARG M:113 , VAL M:114 , VAL M:159BINDING SITE FOR RESIDUE CL M 9318
120GD3SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 9307
121GD4SOFTWAREHIS O:40 , HOH O:5650BINDING SITE FOR RESIDUE CD O 9205
122GD5SOFTWAREHOH 0:7526 , ASN O:44BINDING SITE FOR RESIDUE CL O 9308
123GD6SOFTWAREASN Q:16 , ASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427BINDING SITE FOR RESIDUE NA Q 9148
124GD7SOFTWARESER R:70 , VAL R:72 , NA R:9138 , HOH R:9438 , HOH R:9439 , HOH R:9472BINDING SITE FOR RESIDUE NA R 9137
125GD8SOFTWAREU 0:2659 , G 0:2660 , VAL R:72 , TRP R:75 , NA R:9137 , HOH R:9428 , HOH R:9439BINDING SITE FOR RESIDUE NA R 9138
126GD9SOFTWAREU 0:12 , LYS R:60 , GLN R:61 , ASN R:63 , SR R:9418BINDING SITE FOR RESIDUE NA R 9186
127HC1SOFTWAREC 0:1753 , A 0:1754 , HOH 0:4298 , HOH 0:4735 , HOH 0:8373 , HOH 0:8425BINDING SITE FOR RESIDUE MG 0 8083
128HC2SOFTWAREU 0:1741 , A 0:1742 , G 0:2033 , HOH 0:3365 , HOH 0:4227 , HOH 0:8374BINDING SITE FOR RESIDUE MG 0 8084
129HC3SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4375 , HOH 0:4932 , HOH 0:5056 , MG 0:8059 , HOH 0:9663BINDING SITE FOR RESIDUE MG 0 8085
130HC4SOFTWAREG 0:2540 , G 0:2611 , HOH 0:4871 , NA 0:9139 , HOH 0:9690 , HOH 0:9920BINDING SITE FOR RESIDUE MG 0 8088
131HC5SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:8377 , HOH 0:8426 , HOH 0:8427BINDING SITE FOR RESIDUE MG 0 8089
132HC6SOFTWAREA 0:2103 , U 0:2478 , HOH 0:4207 , HOH 0:4382BINDING SITE FOR RESIDUE MG 0 8090
133HC7SOFTWAREG 0:918 , C 0:2294 , HOH 0:3168 , HOH 0:3922 , HOH 0:7001 , HOH 0:8378 , HOH 0:9718BINDING SITE FOR RESIDUE MG 0 8091
134HC8SOFTWAREA 0:1843 , C 0:1844 , HOH 0:3009 , HOH 0:4236 , HOH 0:8428BINDING SITE FOR RESIDUE MG 0 8092
135HC9SOFTWAREA 0:1070 , G 0:1071 , HOH 0:3303 , HOH 0:4242 , HOH 0:4273 , HOH 0:4313BINDING SITE FOR RESIDUE MG 0 8093
136HD1SOFTWARELYS R:118 , HOH R:9421BINDING SITE FOR RESIDUE CL R 9306
137HD2SOFTWAREGLN R:61 , ASN R:63 , NA R:9186BINDING SITE FOR RESIDUE SR R 9418
138HD3SOFTWAREHIS S:7 , GLU S:61 , HOH S:9482BINDING SITE FOR RESIDUE NA S 9112
139HD4SOFTWAREHOH 0:8420 , ASP S:59BINDING SITE FOR RESIDUE SR S 9470
140HD5SOFTWARETYR T:35 , GLN T:37 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8073
141HD6SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA T 9143
142HD7SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 9201
143HD8SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:9358 , HOH Y:9376 , HOH Y:9407BINDING SITE FOR RESIDUE MG Y 8109
144HD9SOFTWAREHOH 0:5501 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 9320
145IC1SOFTWAREU 0:1096 , C 0:1257 , G 0:1258 , HOH 0:8379BINDING SITE FOR RESIDUE MG 0 8094
146IC2SOFTWAREG 0:1848 , G 0:1849 , HOH 0:4254 , HOH 0:4291 , HOH 0:4419 , HOH 0:4450BINDING SITE FOR RESIDUE MG 0 8096
147IC3SOFTWAREU 0:862 , G 0:863 , U 0:864 , HOH 0:3937 , HOH 0:4263 , HOH 0:4267 , HOH 0:6110BINDING SITE FOR RESIDUE MG 0 8097
148IC4SOFTWAREA 0:907 , HOH 0:3552 , HOH 0:3967 , HOH 0:4275 , HOH 0:4335 , HOH Y:9364BINDING SITE FOR RESIDUE MG 0 8098
149IC5SOFTWAREA 0:2612 , HOH 0:3619 , HOH 0:4258 , HOH 0:4270BINDING SITE FOR RESIDUE MG 0 8099
150IC6SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4334 , HOH 0:5189 , HOH 0:7408BINDING SITE FOR RESIDUE MG 0 8101
151IC7SOFTWAREA 0:2434 , U 0:2458 , HOH 0:3506 , HOH 0:8439 , HOH 0:9876 , HOH 3:9459BINDING SITE FOR RESIDUE MG 0 8102
152IC8SOFTWAREG 0:2578 , G 0:2579 , HOH 0:8430BINDING SITE FOR RESIDUE MG 0 8103
153IC9SOFTWAREC 0:2104 , C 0:2105 , HOH 0:8291BINDING SITE FOR RESIDUE MG 0 8104
154ID1SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 9203
155ID2SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 9202
156ID3SOFTWAREU 0:862 , HOH 0:5448 , HOH 0:9792 , LYS 1:10 , ASN 1:12 , HOH 1:9502BINDING SITE FOR RESIDUE SR 1 9419
157ID4SOFTWAREHOH 0:3829 , HOH 0:4467 , HOH 0:9924 , ASP 1:47 , HOH 1:9476 , HOH 1:9487BINDING SITE FOR RESIDUE SR 1 9460
158ID5SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74BINDING SITE FOR RESIDUE CD 3 9204
159ID6SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 9304
160ID7SOFTWAREHOH 0:4542 , HOH 0:8423 , GLY 3:45 , GLY 3:47 , ASP 3:49BINDING SITE FOR RESIDUE SR 3 9439
161JC1SOFTWAREG 0:817 , HOH 0:4194 , HOH 0:7876 , HOH 0:7881 , MG 0:8043 , HOH 0:8396 , HOH P:181BINDING SITE FOR RESIDUE MG 0 8106
162JC2SOFTWAREC 0:1104 , A 0:1106 , A 0:1107 , HOH 0:8406 , HOH 0:8408BINDING SITE FOR RESIDUE MG 0 8107
163JC3SOFTWAREHOH 0:6634 , HOH 0:7953 , HOH 0:8409 , HOH 0:8410 , HOH 0:8411BINDING SITE FOR RESIDUE MG 0 8108
164JC4SOFTWAREU 0:903 , A 0:1357 , HOH 0:3131 , HOH 0:4511 , HOH 0:5959 , HOH 0:6570BINDING SITE FOR RESIDUE MG 0 8110
165JC5SOFTWAREA 0:187 , HOH 0:3190 , HOH 0:4316 , HOH 0:4355 , HOH 0:9754 , HOH 0:9953BINDING SITE FOR RESIDUE MG 0 8112
166JC6SOFTWAREA 0:2112 , HOH 0:3210 , HOH 0:4340 , HOH 0:4509 , HOH 0:6664 , HOH 0:6920BINDING SITE FOR RESIDUE MG 0 8113
167JC7SOFTWAREA 0:2430 , HOH 0:3074 , HOH 0:4549 , HOH 0:5382 , HOH 0:9970BINDING SITE FOR RESIDUE MG 0 8114
168JC8SOFTWAREHOH 0:4864 , HOH 0:4879 , HOH 0:7118 , MG 0:8116 , HOH A:9546BINDING SITE FOR RESIDUE MG 0 8115
169JC9SOFTWAREU 0:1850 , HOH 0:4254 , HOH 0:4279 , HOH 0:4450 , MG 0:8115 , HOH A:9546BINDING SITE FOR RESIDUE MG 0 8116
170KC1SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:5204 , HOH 0:7077 , HOH 0:9850BINDING SITE FOR RESIDUE MG 0 8117
171KC2SOFTWAREA 0:2637 , HOH 0:8454 , DA 4:179 , C 4:180 , HOH 4:7921 , HOH 4:7923BINDING SITE FOR RESIDUE MG 0 8118
172KC3SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 9001
173KC4SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:9642 , HOH 0:9737 , ARG M:82 , HOH M:9324BINDING SITE FOR RESIDUE K 0 9002
174KC5SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3770 , HOH 0:3800 , HOH 0:5533BINDING SITE FOR RESIDUE NA 0 9101
175KC6SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , HOH 0:8321BINDING SITE FOR RESIDUE NA 0 9102
176KC7SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:4673 , HOH 0:5267 , HOH 0:6338BINDING SITE FOR RESIDUE NA 0 9105
177KC8SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9752BINDING SITE FOR RESIDUE NA 0 9106
178KC9SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 9107
179LC1SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4009 , SR 0:9473BINDING SITE FOR RESIDUE NA 0 9108
180LC2SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:5077BINDING SITE FOR RESIDUE NA 0 9110
181LC3SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:4172 , HOH 0:5221BINDING SITE FOR RESIDUE NA 0 9111
182LC4SOFTWAREG 0:2399 , HOH 0:3560 , HOH 0:4420 , HOH 0:5633 , HOH 0:5683BINDING SITE FOR RESIDUE NA 0 9113
183LC5SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3731 , HOH 0:9954 , TRP B:242BINDING SITE FOR RESIDUE NA 0 9114
184LC6SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:3306BINDING SITE FOR RESIDUE NA 0 9115
185LC7SOFTWAREC 0:896 , A 0:897 , HOH 0:6841 , HOH 0:8225BINDING SITE FOR RESIDUE NA 0 9116
186LC8SOFTWAREG 0:1416 , G 0:1417 , HOH 0:5719 , HOH 0:9900 , TRP 2:42 , ASN 2:45BINDING SITE FOR RESIDUE NA 0 9117
187LC9SOFTWAREG 0:2543 , G 0:2544 , HOH 0:4059 , HOH 0:4515 , HOH 0:7964 , NA 0:9120 , HOH 0:9837BINDING SITE FOR RESIDUE NA 0 9118
188MC1SOFTWAREG 0:2543 , G 0:2544 , U 0:2615 , HOH 0:3356 , NA 0:9118 , HOH 0:9683BINDING SITE FOR RESIDUE NA 0 9120
189MC2SOFTWAREC 0:2287 , ARG H:114BINDING SITE FOR RESIDUE NA 0 9122
190MC3SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:5051BINDING SITE FOR RESIDUE NA 0 9123
191MC4SOFTWAREC 0:130 , U 0:146 , G 0:147 , HOH 0:3115 , HOH 0:4712 , HOH 0:7643BINDING SITE FOR RESIDUE NA 0 9124
192MC5SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3245 , HOH 0:3876 , HOH 0:8200 , SR 0:9441BINDING SITE FOR RESIDUE NA 0 9125
193MC6SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 0 9126
194MC7SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3343 , HOH 0:3805BINDING SITE FOR RESIDUE NA 0 9127
195MC8SOFTWAREG 0:56 , A 0:59 , G 0:61 , HOH 0:5777 , HOH 0:6997BINDING SITE FOR RESIDUE NA 0 9128
196MC9SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:7095BINDING SITE FOR RESIDUE NA 0 9129
197NC1SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9860BINDING SITE FOR RESIDUE NA 0 9130
198NC2SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:3172 , HOH 0:9923BINDING SITE FOR RESIDUE NA 0 9131
199NC3SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7568BINDING SITE FOR RESIDUE NA 0 9132
200NC4SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5810 , HOH 0:8442BINDING SITE FOR RESIDUE NA 0 9134
201NC5SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3486BINDING SITE FOR RESIDUE NA 0 9135
202NC6SOFTWAREG 0:1706 , G 0:1707 , HOH 0:3536 , HOH 0:5899 , HOH 0:7820 , HOH 0:8228BINDING SITE FOR RESIDUE NA 0 9136
203NC7SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , HOH 0:3632 , MG 0:8088BINDING SITE FOR RESIDUE NA 0 9139
204NC8SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3640 , HOH 0:6805 , HOH 0:7323BINDING SITE FOR RESIDUE NA 0 9140
205NC9SOFTWAREG 0:681 , G 0:683 , HOH 0:4604 , HOH 0:8435BINDING SITE FOR RESIDUE NA 0 9141
206OC1SOFTWAREA 0:914 , C 0:915 , C 0:1043 , G 0:1045 , HOH 0:6146BINDING SITE FOR RESIDUE NA 0 9149
207OC2SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:7461BINDING SITE FOR RESIDUE NA 0 9150
208OC3SOFTWAREA 0:955 , HOH 0:7121 , C 9:3081 , U 9:3082BINDING SITE FOR RESIDUE NA 0 9152
209OC4SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5383 , HOH 0:8135BINDING SITE FOR RESIDUE NA 0 9154
210OC5SOFTWAREG 0:1119 , C 0:1243 , HOH 0:5375 , THR J:47BINDING SITE FOR RESIDUE NA 0 9155
211OC6SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:3077BINDING SITE FOR RESIDUE NA 0 9156
212OC7SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:6804BINDING SITE FOR RESIDUE NA 0 9157
213OC8SOFTWAREG 0:2611 , HOH 0:3108 , HOH 0:4327 , MG 0:8009 , HOH 0:8319 , HOH 0:9956BINDING SITE FOR RESIDUE NA 0 9158
214OC9SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 9159
215PC1SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6496BINDING SITE FOR RESIDUE NA 0 9160
216PC2SOFTWAREU 0:837 , HOH 0:5159 , HOH 0:5662 , HOH 0:7324 , GLN B:230 , GLY B:231BINDING SITE FOR RESIDUE NA 0 9161
217PC3SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277 , HOH 0:5870BINDING SITE FOR RESIDUE NA 0 9162
218PC4SOFTWAREU 0:1359 , C 0:1360 , HOH 0:4072 , HOH 0:7542BINDING SITE FOR RESIDUE NA 0 9163
219PC5SOFTWAREU 0:2057 , G 0:2058 , HOH 0:3428BINDING SITE FOR RESIDUE NA 0 9164
220PC6SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , ALA M:194BINDING SITE FOR RESIDUE NA 0 9165
221PC7SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3499 , HOH 0:4406 , HOH 0:4466BINDING SITE FOR RESIDUE NA 0 9166
222PC8SOFTWAREG 0:464 , G 0:475 , HOH 0:3443 , HOH 0:5050 , HOH 0:5172 , ARG C:55BINDING SITE FOR RESIDUE NA 0 9167
223PC9SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 0 9168
224QC1SOFTWAREU 0:391 , U 0:392 , A 0:395 , HOH 0:3364 , HOH 0:7089 , SR 0:9461 , HOH 3:9494BINDING SITE FOR RESIDUE NA 0 9169
225QC2SOFTWAREU 0:1831 , HOH 0:4362 , HOH 0:9730BINDING SITE FOR RESIDUE NA 0 9170
226QC3SOFTWAREG 0:2491 , U 0:2492 , U 0:2528 , G 0:2529 , HOH 0:3246BINDING SITE FOR RESIDUE NA 0 9171
227QC4SOFTWAREU 0:919 , G 0:921 , G 0:924 , HOH 0:9896BINDING SITE FOR RESIDUE NA 0 9172
228QC5SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:7777BINDING SITE FOR RESIDUE NA 0 9173
229QC6SOFTWAREC 0:195 , G 0:196 , A 0:415 , HOH 0:3511BINDING SITE FOR RESIDUE NA 0 9174
230QC7SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9887BINDING SITE FOR RESIDUE NA 0 9175
231QC8SOFTWAREG 0:911 , U 0:1293 , G 0:1295 , HOH 0:6869BINDING SITE FOR RESIDUE NA 0 9177
232QC9SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3809 , HIS L:18 , HOH L:9428 , HOH L:9446BINDING SITE FOR RESIDUE NA 0 9178
233RC1SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:4304 , HOH 0:4998 , HOH 0:5572BINDING SITE FOR RESIDUE NA 0 9179
234RC2SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4281 , HOH 0:9952BINDING SITE FOR RESIDUE NA 0 9181
235RC3SOFTWAREG 0:2772 , G 0:2773BINDING SITE FOR RESIDUE NA 0 9182
236RC4SOFTWAREC 0:197 , HOH 0:5813BINDING SITE FOR RESIDUE NA 0 9184
237RC5SOFTWAREA 0:1079 , HOH 0:5757 , HOH 0:8221BINDING SITE FOR RESIDUE NA 0 9185
238RC6SOFTWAREG 0:1452 , G 0:1676 , LYS 2:2BINDING SITE FOR RESIDUE CL 0 9303
239RC7SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 0 9305
240RC8SOFTWAREC 0:2388 , HOH 0:3764 , PHE Q:52 , HIS Q:53 , PHE Q:56BINDING SITE FOR RESIDUE CL 0 9311
241RC9SOFTWAREG 0:2582 , A 0:2596 , LYS K:14 , SER K:33BINDING SITE FOR RESIDUE CL 0 9312
242SC1SOFTWAREA 0:1328 , A 0:1329 , HOH 0:5226 , HOH 0:5516BINDING SITE FOR RESIDUE CL 0 9313
243SC2SOFTWAREG 0:644 , HIS L:13 , HOH L:9487BINDING SITE FOR RESIDUE CL 0 9314
244SC3SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 9315
245SC4SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 9316
246SC5SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:9352BINDING SITE FOR RESIDUE CL 0 9317
247SC6SOFTWAREG 0:1072 , G 0:1087 , A 0:1291 , HOH 0:5891BINDING SITE FOR RESIDUE CL 0 9322
248SC7SOFTWAREG 0:824 , G 0:854 , HOH 0:4543 , HOH 0:4869 , HOH 0:5102BINDING SITE FOR RESIDUE SR 0 9405
249SC8SOFTWAREG 0:836 , U 0:2615 , HOH 0:4424 , HOH 0:9894 , HOH 0:9983 , GLN B:230BINDING SITE FOR RESIDUE SR 0 9406
250SC9SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3020 , HOH 0:4225 , HOH 0:4541 , HOH 0:6705BINDING SITE FOR RESIDUE SR 0 9407
251TC1SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:3955 , HOH 0:8299 , HOH 0:9635 , HOH 0:9727BINDING SITE FOR RESIDUE SR 0 9408
252TC2SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:3055 , HOH 0:7097 , HOH 0:8445BINDING SITE FOR RESIDUE SR 0 9410
253TC3SOFTWAREA 0:1754 , A 0:1755 , HOH 0:7106 , HOH 0:7656 , HOH 0:8133BINDING SITE FOR RESIDUE SR 0 9411
254TC4SOFTWAREC 0:893 , HOH 0:6182 , HOH 0:8444 , HOH C:9541BINDING SITE FOR RESIDUE SR 0 9412
255TC5SOFTWAREG 0:1055 , HOH 0:4412 , HOH 0:5392 , HOH 0:6857 , ASP H:10 , HOH H:9507BINDING SITE FOR RESIDUE SR 0 9413
256TC6SOFTWAREU 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:9442BINDING SITE FOR RESIDUE SR 0 9414
257TC7SOFTWAREHOH 0:4354 , HOH 0:6063 , HOH 0:6687 , HOH 0:7110 , HOH 0:8380 , HOH 0:8381BINDING SITE FOR RESIDUE SR 0 9415
258TC8SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3297BINDING SITE FOR RESIDUE SR 0 9416
259TC9SOFTWAREC 0:85 , A 0:86 , C 0:87 , HOH 0:5914 , ASP T:68BINDING SITE FOR RESIDUE SR 0 9417
260UC1SOFTWAREHOH 0:4733 , HOH 0:5444 , HOH 0:5782BINDING SITE FOR RESIDUE SR 0 9420
261UC2SOFTWAREU 0:664 , G 0:681 , HOH 0:7430 , HOH C:9536BINDING SITE FOR RESIDUE SR 0 9421
262UC3SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4682 , HOH 0:5997 , HOH 0:6323BINDING SITE FOR RESIDUE SR 0 9422
263UC4SOFTWAREU 0:454 , C 0:478 , HOH 0:4801 , HOH 0:6201 , HOH 0:6680BINDING SITE FOR RESIDUE SR 0 9423
264UC5SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:8312 , HOH 0:8313BINDING SITE FOR RESIDUE SR 0 9424
265UC6SOFTWAREG 0:2543 , C 0:2608 , HOH 0:8453 , C 4:74BINDING SITE FOR RESIDUE SR 0 9425
266UC7SOFTWAREG 0:2632 , HOH 0:3896 , HOH 0:5114 , HOH 0:6037BINDING SITE FOR RESIDUE SR 0 9426
267UC8SOFTWAREA 0:1717 , G 0:1718 , HOH 0:5122 , HOH 0:5903 , HOH 0:6907BINDING SITE FOR RESIDUE SR 0 9427
268UC9SOFTWAREG 0:471 , HOH 0:3644 , HOH 0:4971 , HOH 0:6172 , HOH 0:9829 , HOH 0:9867BINDING SITE FOR RESIDUE SR 0 9428
269VC1SOFTWAREG 0:1059 , C 0:1127 , HOH 0:4408 , HOH 0:5435 , HOH 0:5877 , HOH 0:9741BINDING SITE FOR RESIDUE SR 0 9429
270VC2SOFTWAREA 0:639 , G 0:640 , HOH 0:3249 , HOH 0:3516 , HOH 0:4570 , HOH 0:5384 , HOH 0:5828 , HOH 0:6587BINDING SITE FOR RESIDUE SR 0 9430
271VC3SOFTWAREG 0:2725 , G 0:2755 , HOH 0:3870 , HOH 0:4399 , HOH 0:5639 , HOH 0:6867 , HOH 0:7185BINDING SITE FOR RESIDUE SR 0 9431
272VC4SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 9432
273VC5SOFTWAREHOH 0:3938 , HOH 0:6334 , HOH 0:6968BINDING SITE FOR RESIDUE SR 0 9433
274VC6SOFTWAREA 0:2553 , HOH 0:3209 , HOH 0:4240BINDING SITE FOR RESIDUE SR 0 9434
275VC7SOFTWAREU 0:1109 , G 0:1110 , A 0:1247 , HOH 0:4048 , HOH 0:7471BINDING SITE FOR RESIDUE SR 0 9435
276VC8SOFTWAREG 0:1543 , HOH 0:5550 , HOH 0:6622 , HOH 0:6633BINDING SITE FOR RESIDUE SR 0 9438
277VC9SOFTWAREA 0:532 , U 0:533 , HOH 0:4322 , HOH 0:4560 , HOH 0:8375 , HOH 0:8376BINDING SITE FOR RESIDUE SR 0 9440
278WC1SOFTWAREU 0:777 , U 0:864 , HOH 0:3245 , HOH 0:3876 , HOH 0:4263 , HOH 0:4267 , HOH 0:7936 , MG 0:8031 , NA 0:9125BINDING SITE FOR RESIDUE SR 0 9441
279WC2SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8403 , HOH 0:8404BINDING SITE FOR RESIDUE SR 0 9442
280WC3SOFTWAREA 0:1291 , G 0:1292 , HOH 0:4206 , HOH 0:7926 , HOH 0:8385BINDING SITE FOR RESIDUE SR 0 9443
281WC4SOFTWAREC 0:880 , A 0:882 , U 0:883 , HOH 0:4215 , HOH 0:8370 , HOH 0:8371 , HOH 0:9866BINDING SITE FOR RESIDUE SR 0 9444
282WC5SOFTWAREHOH 0:4872 , HOH 0:7019 , HOH 0:7996BINDING SITE FOR RESIDUE SR 0 9445
283WC6SOFTWAREHOH 0:5582 , HOH 0:5744 , HOH 0:6672BINDING SITE FOR RESIDUE SR 0 9446
284WC7SOFTWAREG 0:84 , C 0:85 , HOH 0:5914 , ASP T:68 , HOH T:4745BINDING SITE FOR RESIDUE SR 0 9447
285WC8SOFTWAREA 0:2465 , G 0:2466 , HOH 0:4840 , HOH 0:8441 , ASP L:36 , HOH L:9433BINDING SITE FOR RESIDUE SR 0 9448
286WC9SOFTWAREG 0:1683 , U 0:1696 , HOH 0:3398 , HOH 0:5323 , HOH 0:5404BINDING SITE FOR RESIDUE SR 0 9449
287XC1SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:6423 , HOH 0:6792 , HOH 0:8438BINDING SITE FOR RESIDUE SR 0 9450
288XC2SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6656 , HOH 0:7852BINDING SITE FOR RESIDUE SR 0 9451
289XC3SOFTWAREU 0:2016 , HOH 0:8095BINDING SITE FOR RESIDUE SR 0 9452
290XC4SOFTWAREG 0:1484 , HOH 0:4306 , HOH 0:8336 , HOH 0:8391 , HOH 0:8392BINDING SITE FOR RESIDUE SR 0 9453
291XC5SOFTWAREG 0:2091 , HOH 0:3689 , HOH 0:6641 , HOH 0:7193BINDING SITE FOR RESIDUE SR 0 9454
292XC6SOFTWAREC 0:1690 , HOH 0:3070 , HOH 0:4331 , HOH 0:4633 , HOH 0:5273BINDING SITE FOR RESIDUE SR 0 9455
293XC7SOFTWAREA 0:2302 , A 0:2303 , HOH 0:4235 , HOH 0:4357 , HOH 0:5432BINDING SITE FOR RESIDUE SR 0 9456
294XC8SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , HOH 0:3420 , HOH 0:4210 , HOH 0:4341BINDING SITE FOR RESIDUE SR 0 9457
295XC9SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 9459
296YC1SOFTWAREU 0:391 , HOH 0:3630 , HOH 0:6950 , NA 0:9169 , ARG 3:42BINDING SITE FOR RESIDUE SR 0 9461
297YC2SOFTWAREG 0:2810 , HOH 0:4630 , HOH 0:8142 , ASN B:27BINDING SITE FOR RESIDUE SR 0 9462
298YC3SOFTWAREU 0:2557 , HOH 0:3660 , HOH 0:7176BINDING SITE FOR RESIDUE SR 0 9464
299YC4SOFTWAREA 0:682 , G 0:683 , HOH 0:8435 , HOH 0:8447BINDING SITE FOR RESIDUE SR 0 9465
300YC5SOFTWAREC 0:1462 , A 0:1463 , GLY 1:40BINDING SITE FOR RESIDUE SR 0 9466
301YC6SOFTWAREA 0:1133 , G 0:1134 , HOH 0:4944 , HOH 0:5358BINDING SITE FOR RESIDUE SR 0 9467
302YC7SOFTWAREU 0:1972 , HOH 0:3290 , HOH 0:3901BINDING SITE FOR RESIDUE SR 0 9468
303YC8SOFTWAREG 0:1113 , HOH 0:4285 , HOH 0:4295BINDING SITE FOR RESIDUE SR 0 9469
304YC9SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4036 , HOH 0:4185 , NA 0:9108BINDING SITE FOR RESIDUE SR 0 9473
305ZC1SOFTWAREG 0:2284 , HOH 0:6075 , HOH 0:7691 , HOH 0:8250BINDING SITE FOR RESIDUE SR 0 9474
306ZC2SOFTWAREG 0:2777 , HOH 0:4781 , HOH 0:7832BINDING SITE FOR RESIDUE SR 0 9475
307ZC3SOFTWAREA 0:1815 , HOH 0:8053 , HOH 0:8364 , HOH 0:8365BINDING SITE FOR RESIDUE SR 0 9477
308ZC4SOFTWAREC 0:235 , HOH 0:5268 , HOH 0:6007 , HOH 0:6688 , HOH 0:8069BINDING SITE FOR RESIDUE SR 0 9478
309ZC5SOFTWAREU 0:2690 , HOH 0:3656 , HOH 0:6093BINDING SITE FOR RESIDUE SR 0 9480
310ZC6SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5440 , GLY L:14 , HOH L:9488BINDING SITE FOR RESIDUE SR 0 9482
311ZC7SOFTWAREA 0:565 , G 0:592 , HOH 0:5780BINDING SITE FOR RESIDUE SR 0 9483
312ZC8SOFTWAREHOH 0:6972 , HOH 0:7778 , HOH 0:7920BINDING SITE FOR RESIDUE SR 0 9488
313ZC9SOFTWAREU 0:1835 , HOH 0:3583BINDING SITE FOR RESIDUE SR 0 9489

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VQL)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:111-127
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:126-140
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1VQL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1vql 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1vql11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1vql100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1vql101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1vql 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1vql21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1vql200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1vql201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1vql 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1vql31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1vql300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....eee.........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1vql 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 4 from PDB  Type:DNA/RNA  Length:7
                                        
                1vql 4   74 CCaxACC  181
                              ||   
                             76-PPU
                             178-TSE

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1vql 9 3001 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC 3122
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100      3110      3120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1vqla2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1vqla1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1vqlA01 A:1-78 Nucleic acid-binding proteins                                  ---1vqlA02 A:82-159  [code=2.30.30.30, no name defined]                          1vqlA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1vqlA02 A:10-82                                             -----Ribosomal_L2_C-1vqlA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeee..........eee...........eee.hhh...eeee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1vqlb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1vqlB01 B:1-38,B:207-257              1vqlB02 B:39-77,B:189-206,B:258-337    1vqlB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1vqlB02           1vqlB01 B:1-38,B:207-257                           1vqlB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1vqlB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee.....eehhhhhhh....hhhhhh.........................ee....eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1vqlc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1vqlC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1vqlC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhh..........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhhh..ee..hhhhhhh..ee.....eeee..............eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vql C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1vqld1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1vqlD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1vqlD0     1 D:11-64                     ---Ribosomal_L5_C-1vqlD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhh....eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee...hhhhh..............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1vqle1 E:1-79 Ribosomal protein L6                                            d1vqle2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1vqlE01 E:1-79  [code=3.90.930.12, no name defined]                            1vqlE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqlE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqlE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeeee..eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1vqlf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1vqlF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1vqlF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhh....eeee....hhhhh.hhhhhhhh....eeee.hhhhhhhhh.......eeee.....hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vql F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1vqlg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1vql G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1vqlh1 H:1-163 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1vqlH00 H:1-171  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee....hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhhhhh...eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql H    1 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA  171
                                    10        20        30        40        50        60        70        80        90        |-         -|      120       130       140       150       160       170 
                                                                                                                             99         111                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1vqli1 I:71-140 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1vqlI00 I:71-140  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1vqlI01 I:71-139                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhhh.............eeeehhhhhhhhhhh.......hhhhhhhhhh.......eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1vql I   71 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  140
                                    80        90       100       110       120       130       140

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1vqlj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1vqlJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1vqlJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee..................hhhhh..eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1vqlk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1vqlK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1vqlK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vql K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1vqll1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1vqlL01 L:1-50                                    1vqlL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1vqlL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vql L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1vqlm1 M:1-194 Ribosomal protein L15e                                                                                                                                                             SCOP domains
               CATH domains 1vqlM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1vqlM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhhh........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1vqln1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1vqlN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1vqlN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vql N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1vqlo1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1vqlO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1vqlO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhh......eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1vql O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1vqlp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1vqlP01 P:1-55  [code=1.10.1650.10, no name defined]   1vqlP02 P:56-88 Single Heli x bin1vqlP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1vqlq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1vqlQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1vqlQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhhh......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1vql Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1vqlr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1vqlR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1vqlR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vql R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1vqls1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1vqlS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1vqlS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1vql S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1vqlt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1vqlT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1vqlT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vql T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1vqlu1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1vqlU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1vqlU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1vql U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1vqlv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1vqlV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1vqlV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1vql V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1vqlw1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1vqlW01 W:1-57,W:114-154                                 1vqlW02 W:58-113  [code=1.10.15.30, no name defined]    1vqlW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1vqlW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhh.....hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1vqlx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1vqlX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1vqlX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1vql X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1vqly1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1vqlY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhh.........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vql Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1vqlz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1vqlZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1vqlZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh...........eeeee..eeee....eeee.........hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1vql Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric/Biological Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    C  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PPU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    HD9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    ID1  [ RasMol ]  +environment [ RasMol ]
    ID2  [ RasMol ]  +environment [ RasMol ]
    ID3  [ RasMol ]  +environment [ RasMol ]
    ID4  [ RasMol ]  +environment [ RasMol ]
    ID5  [ RasMol ]  +environment [ RasMol ]
    ID6  [ RasMol ]  +environment [ RasMol ]
    ID7  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vql
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P606171ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P158251jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P141221c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P291981ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P224501c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P606181ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P127371ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P127331ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P141231ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P141191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P127341ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P109701ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P127321ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P141161ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P109721ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P109711ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P202761c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P141211ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P181381ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P127361ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P606191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P324101ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P224521ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P202791ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P324111ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P127351ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P141241ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P141351c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P127431ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

1ffk 1ffz 1fgo 1jj2 1kqs 1m90 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vqm 1vqn 1vqo 1vqp