1VQK | RR0106 - JenaLib

Asymmetric Unit (310, 310)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	G 0:2482 , A 0:2483 , A 0:2532 , C 0:2533 , C 0:2534 , HOH 0:4219 , HOH 0:8344 , HOH 0:9804	BINDING SITE FOR RESIDUE MG 0 8001
002	AC2	SOFTWARE	G 0:627 , A 0:2483 , C 0:2534 , U 0:2535 , HOH 0:8323 , HOH 0:9888	BINDING SITE FOR RESIDUE MG 0 8002
003	AC3	SOFTWARE	A 0:876 , G 0:877 , A 0:2624 , HOH 0:4270 , HOH A:9499 , HOH A:9520	BINDING SITE FOR RESIDUE MG 0 8003
004	AC4	SOFTWARE	G 0:456 , A 0:459 , HOH 0:3393 , HOH 0:4386 , HOH 0:8329 , HOH 0:9673	BINDING SITE FOR RESIDUE MG 0 8004
005	AC5	SOFTWARE	A 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4216 , HOH 0:8345 , HOH 0:8346	BINDING SITE FOR RESIDUE MG 0 8005
006	AC6	SOFTWARE	U 0:919 , C 0:2464 , A 0:2465 , HOH 0:4233 , HOH 0:8338 , HOH 0:8417	BINDING SITE FOR RESIDUE MG 0 8008
007	AC7	SOFTWARE	U 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4341 , HOH 0:7924 , HOH 0:8339 , NA 0:9158 , HOH 0:9960	BINDING SITE FOR RESIDUE MG 0 8009
008	AC8	SOFTWARE	G 0:28 , U 0:1304 , HOH 0:3264 , HOH 0:3837 , HOH 0:4251 , HOH 0:8418 , HOH 0:9665	BINDING SITE FOR RESIDUE MG 0 8012
009	AC9	SOFTWARE	G 0:877 , G 0:2623 , A 0:2624 , HOH 0:4246 , HOH A:9614	BINDING SITE FOR RESIDUE MG 0 8013
010	AD1	SOFTWARE	HOH 0:4107	BINDING SITE FOR RESIDUE SR 0 9501
011	AD2	SOFTWARE	G 0:1290 , A 0:1291 , HOH 0:5550 , HOH 0:8419	BINDING SITE FOR RESIDUE SR 0 9504
012	AD3	SOFTWARE	A 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752	BINDING SITE FOR RESIDUE SR 0 9505
013	AD4	SOFTWARE	A 0:632 , C 0:633 , A 0:2538 , U 0:2539 , HOH 0:4250 , HOH 0:5449 , HOH 0:8479	BINDING SITE FOR RESIDUE SR 0 9506
014	AD5	SOFTWARE	G 0:911 , G 0:1292 , HOH 0:3423 , HOH 0:3671 , HOH 0:4002 , HOH 0:4865	BINDING SITE FOR RESIDUE SR 0 9508
015	AD6	SOFTWARE	A 0:378 , G 0:379 , A 0:429 , HOH 0:5158 , HOH 0:7979	BINDING SITE FOR RESIDUE SR 0 9509
016	AD7	SOFTWARE	U 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:8476	BINDING SITE FOR RESIDUE SR 0 9515
017	AD8	SOFTWARE	C 0:1103 , HOH 0:3172 , GLU J:28	BINDING SITE FOR RESIDUE SR 0 9517
018	AD9	SOFTWARE	G 0:2700	BINDING SITE FOR RESIDUE SR 0 9522
019	BC1	SOFTWARE	A 0:2101 , G 0:2102 , G 0:2537 , HOH 0:4263 , HOH 0:8320	BINDING SITE FOR RESIDUE MG 0 8014
020	BC2	SOFTWARE	A 0:844 , A 0:1689 , HOH 0:4225 , HOH 0:8353 , HOH 0:9633 , HOH 0:9650	BINDING SITE FOR RESIDUE MG 0 8015
021	BC3	SOFTWARE	G 0:456 , HOH 0:3044 , HOH 0:8330 , GLY C:86 , HOH C:9164 , HOH C:9167 , HOH C:9271	BINDING SITE FOR RESIDUE MG 0 8017
022	BC4	SOFTWARE	A 0:2011 , HOH 0:4751 , HOH 0:7748 , HOH 0:8349 , HOH 0:8350 , HOH 0:8351	BINDING SITE FOR RESIDUE MG 0 8019
023	BC5	SOFTWARE	C 0:1830 , HOH 0:8333 , HOH 0:8352 , HOH 0:9748 , HOH 0:9751 , HOH 0:9825	BINDING SITE FOR RESIDUE MG 0 8020
024	BC6	SOFTWARE	G 0:2304 , U 0:2306 , HOH 0:3580 , HOH 0:4243 , HOH 0:8336 , HOH 0:8337	BINDING SITE FOR RESIDUE MG 0 8021
025	BC7	SOFTWARE	G 0:2097 , G 0:2540 , HOH 0:5311 , HOH 0:9737	BINDING SITE FOR RESIDUE MG 0 8022
026	BC8	SOFTWARE	A 0:1381 , HOH 0:3553 , HOH 0:8420	BINDING SITE FOR RESIDUE MG 0 8024
027	BC9	SOFTWARE	U 0:1120 , G 0:1121 , HOH 0:4769 , HOH 0:8356	BINDING SITE FOR RESIDUE MG 0 8025
028	BD1	SOFTWARE	A 0:2622 , G 0:2623 , HOH 0:5224 , HOH 0:6438 , HOH 0:7722	BINDING SITE FOR RESIDUE SR 0 9529
029	BD2	SOFTWARE	G 0:2617 , G 0:2618 , HOH 0:4231 , HOH 0:4325 , HOH 0:4489 , HOH 0:8355	BINDING SITE FOR RESIDUE SR 0 9530
030	BD3	SOFTWARE	A 0:1427 , HOH 0:5501	BINDING SITE FOR RESIDUE SR 0 9532
031	BD4	SOFTWARE	U 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3217 , HOH 0:4356 , HOH 0:4364	BINDING SITE FOR RESIDUE SR 0 9534
032	BD5	SOFTWARE	A 0:846 , G 0:1694 , G 0:1695	BINDING SITE FOR RESIDUE SR 0 9539
033	BD6	SOFTWARE	G 0:2609 , U 0:2610 , HOH 0:3907 , HOH 0:4324 , HOH 0:6170 , HOH 0:6315 , HOH B:9656	BINDING SITE FOR RESIDUE SR 0 9545
034	BD7	SOFTWARE	A 0:1411 , A 0:1682 , HOH 0:4069 , HOH 0:7608	BINDING SITE FOR RESIDUE SR 0 9547
035	BD8	SOFTWARE	HOH 0:6290	BINDING SITE FOR RESIDUE SR 0 9560
036	BD9	SOFTWARE	G 0:834 , U 0:835 , HOH 0:4510 , HOH 0:5061 , HOH 0:6679	BINDING SITE FOR RESIDUE SR 0 9566
037	CC1	SOFTWARE	C 0:2608 , G 0:2609 , U 0:2610 , HOH 0:8357 , HOH 0:8358 , HOH 0:8359	BINDING SITE FOR RESIDUE MG 0 8026
038	CC2	SOFTWARE	C 0:240 , G 0:269 , HOH 0:4475 , HOH 0:4615 , HOH 0:4756 , HOH 0:8423	BINDING SITE FOR RESIDUE MG 0 8027
039	CC3	SOFTWARE	A 0:1448 , U 0:1677 , HOH 0:4282 , HOH 0:4303 , HOH 0:4314 , HOH S:9502	BINDING SITE FOR RESIDUE MG 0 8028
040	CC4	SOFTWARE	U 0:1503 , A 0:1504 , C 0:1679 , HOH 0:8362 , HOH 0:8364	BINDING SITE FOR RESIDUE MG 0 8029
041	CC5	SOFTWARE	U 0:1748 , U 0:1749 , HOH 0:4244 , HOH 0:8331 , HOH 0:8332 , HOH 0:8342	BINDING SITE FOR RESIDUE MG 0 8030
042	CC6	SOFTWARE	U 0:777 , C 0:778 , HOH 0:3885 , HOH 0:7958 , HOH 0:7969 , HOH 0:8366 , SR 0:9441 , HOH 1:9510	BINDING SITE FOR RESIDUE MG 0 8031
043	CC7	SOFTWARE	U 0:2115 , G 0:2272 , HOH 0:3606 , HOH 0:4392 , HOH 0:4790 , HOH 0:8367 , ALA A:196 , HOH A:9535	BINDING SITE FOR RESIDUE MG 0 8032
044	CC8	SOFTWARE	G 0:956 , HOH 0:4274 , HOH 0:8371 , HOH 0:8372 , HOH 0:8373 , HOH 0:9993	BINDING SITE FOR RESIDUE MG 0 8036
045	CC9	SOFTWARE	A 0:2553 , HOH 0:3748 , HOH 0:3820 , HOH 0:4252 , HOH 0:8427 , HOH 0:9704	BINDING SITE FOR RESIDUE MG 0 8037
046	CD1	SOFTWARE	U 0:2461 , HOH 0:6794 , ASP 3:59	BINDING SITE FOR RESIDUE SR 0 9568
047	CD2	SOFTWARE	C 0:1536	BINDING SITE FOR RESIDUE SR 0 9570
048	CD3	SOFTWARE	U 0:2589 , U 0:2590 , C 0:2591 , HOH 0:6164 , HOH 0:6483	BINDING SITE FOR RESIDUE SR 0 9581
049	CD4	SOFTWARE	A 0:1317 , SER Y:207	BINDING SITE FOR RESIDUE SR 0 9585
050	CD5	SOFTWARE	G 0:2102 , A 0:2103 , HOH 0:4218	BINDING SITE FOR RESIDUE SR 0 9590
051	CD6	SOFTWARE	G 0:2639	BINDING SITE FOR RESIDUE SR 0 9601
052	CD7	SOFTWARE	G 0:1376 , A 0:1693 , HOH 0:5074	BINDING SITE FOR RESIDUE SR 0 9626
053	CD8	SOFTWARE	U 0:1368 , HOH 0:5466 , HOH 0:6354 , HOH 0:6408 , HOH R:9464	BINDING SITE FOR RESIDUE SR 0 9629
054	CD9	SOFTWARE	A 9:3056 , A 9:3057 , HOH 9:5822 , HOH 9:7361	BINDING SITE FOR RESIDUE MG 9 8095
055	DC1	SOFTWARE	HOH 0:4229 , HOH 0:4253 , HOH 0:4275 , HOH 0:4277 , HOH 0:8375 , HOH 0:9909	BINDING SITE FOR RESIDUE MG 0 8038
056	DC2	SOFTWARE	U 0:115 , HOH 0:3526 , HOH 0:4461 , HOH 0:4567 , HOH 0:5682 , HOH 0:6223 , HOH 0:8377	BINDING SITE FOR RESIDUE MG 0 8039
057	DC3	SOFTWARE	U 0:392 , HOH 0:8429 , ARG M:85 , HOH M:9339	BINDING SITE FOR RESIDUE MG 0 8040
058	DC4	SOFTWARE	G 0:196 , A 0:227 , C 0:228 , HOH 0:4708 , HOH 0:4801	BINDING SITE FOR RESIDUE MG 0 8041
059	DC5	SOFTWARE	U 0:1309 , U 0:1346 , HOH 0:3066 , HOH 0:4261 , HOH 0:5014 , HOH 0:8378	BINDING SITE FOR RESIDUE MG 0 8042
060	DC6	SOFTWARE	G 0:816 , G 0:817 , HOH 0:3430 , HOH 0:7914 , MG 0:8106 , HOH 0:8431	BINDING SITE FOR RESIDUE MG 0 8043
061	DC7	SOFTWARE	C 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3903 , GLY R:65 , HOH R:9499	BINDING SITE FOR RESIDUE MG 0 8044
062	DC8	SOFTWARE	G 0:1979 , HOH 0:8379 , HOH 0:8432 , HOH 0:8434	BINDING SITE FOR RESIDUE MG 0 8045
063	DC9	SOFTWARE	G 0:1794 , HOH 0:7803 , HOH 0:8435 , HOH 0:8436	BINDING SITE FOR RESIDUE MG 0 8046
064	DD1	SOFTWARE	G 9:3021 , G 9:3022 , U 9:3055 , A 9:3057 , G 9:3058	BINDING SITE FOR RESIDUE NA 9 9183
065	DD2	SOFTWARE	HOH 0:5584 , C 9:3091 , HOH H:9526	BINDING SITE FOR RESIDUE SR 9 9481
066	DD3	SOFTWARE	G 9:3078 , G 9:3102	BINDING SITE FOR RESIDUE SR 9 9503
067	DD4	SOFTWARE	HOH 9:120 , A 9:3044 , HOH 9:4351	BINDING SITE FOR RESIDUE SR 9 9588
068	DD5	SOFTWARE	G 0:1873 , HOH 0:4945 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120	BINDING SITE FOR RESIDUE MG A 8066
069	DD6	SOFTWARE	HOH 0:6940 , LYS A:178	BINDING SITE FOR RESIDUE CL A 9309
070	DD7	SOFTWARE	A 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9542 , HOH A:9583	BINDING SITE FOR RESIDUE SR A 9436
071	DD8	SOFTWARE	HOH 0:4945 , HOH 0:6493 , HOH 0:8466 , GLU A:28	BINDING SITE FOR RESIDUE SR A 9437
072	DD9	SOFTWARE	GLU A:28	BINDING SITE FOR RESIDUE SR A 9497
073	EC1	SOFTWARE	G 0:1099 , HOH 0:5087 , HOH 0:7582 , HOH 0:8448	BINDING SITE FOR RESIDUE MG 0 8047
074	EC2	SOFTWARE	C 0:2248 , HOH 0:7826	BINDING SITE FOR RESIDUE MG 0 8050
075	EC3	SOFTWARE	G 0:641 , A 0:1355 , HOH 0:4704 , HOH 0:8380 , HOH 0:8381	BINDING SITE FOR RESIDUE MG 0 8051
076	EC4	SOFTWARE	U 0:1125 , HOH 0:8450 , HOH 9:737 , G 9:3090	BINDING SITE FOR RESIDUE MG 0 8052
077	EC5	SOFTWARE	C 0:162 , U 0:2276 , HOH 0:3062 , HOH 0:8335 , HOH 0:8382 , HOH 0:8383	BINDING SITE FOR RESIDUE MG 0 8054
078	EC6	SOFTWARE	A 0:2719 , A 0:2757 , HOH 0:4272 , HOH 0:8401 , ASN B:335 , HOH B:9539	BINDING SITE FOR RESIDUE MG 0 8056
079	EC7	SOFTWARE	U 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5597 , HOH 0:8451 , GLN A:207	BINDING SITE FOR RESIDUE MG 0 8057
080	EC8	SOFTWARE	G 0:1884 , G 0:2013 , HOH 0:4367 , HOH 0:8384 , HOH 0:8385	BINDING SITE FOR RESIDUE MG 0 8058
081	EC9	SOFTWARE	G 0:2618 , HOH 0:4325 , HOH 0:4489 , HOH 0:4652 , HOH 0:8343 , HOH 0:9664 , HOH 0:9668	BINDING SITE FOR RESIDUE MG 0 8059
082	ED1	SOFTWARE	GLY B:337 , HOH B:9551 , HOH B:9661 , HOH B:9662 , HOH B:9663	BINDING SITE FOR RESIDUE MG B 8055
083	ED2	SOFTWARE	HOH 0:3210 , ARG B:223 , LYS B:224 , HIS B:227	BINDING SITE FOR RESIDUE CL B 9319
084	ED3	SOFTWARE	HOH 0:3566 , HOH 0:3856 , ASN B:243 , SER B:245	BINDING SITE FOR RESIDUE SR B 9458
085	ED4	SOFTWARE	C 0:2672 , PRO B:24 , ARG B:25 , ARG B:310	BINDING SITE FOR RESIDUE SR B 9521
086	ED5	SOFTWARE	ASP C:45 , THR C:94 , LYS C:96 , HOH C:9111	BINDING SITE FOR RESIDUE NA C 9104
087	ED6	SOFTWARE	ARG D:51 , PRO D:68	BINDING SITE FOR RESIDUE NA D 9151
088	ED7	SOFTWARE	HOH 0:5686	BINDING SITE FOR RESIDUE SR F 9595
089	ED8	SOFTWARE	A 0:1133 , G 0:1134 , TYR H:154 , ILE H:157 , THR H:158 , PRO H:159	BINDING SITE FOR RESIDUE SR H 9486
090	ED9	SOFTWARE	HOH 0:3112 , HOH 0:6324 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69	BINDING SITE FOR RESIDUE NA J 9146
091	FC1	SOFTWARE	G 0:175 , U 0:224 , HOH 0:8388 , HOH 0:8389 , HOH 0:9797	BINDING SITE FOR RESIDUE MG 0 8060
092	FC2	SOFTWARE	A 0:1369 , U 0:2650 , HOH 0:8390 , HOH 0:8391 , HOH 0:8392	BINDING SITE FOR RESIDUE MG 0 8061
093	FC3	SOFTWARE	HOH 0:4781 , HOH 0:5617 , HOH 0:7531 , HOH 0:8328 , HOH 0:8400	BINDING SITE FOR RESIDUE MG 0 8063
094	FC4	SOFTWARE	G 0:782 , C 0:783 , HOH 0:3542 , HOH 0:6563 , HOH A:9510 , HOH A:9616	BINDING SITE FOR RESIDUE MG 0 8065
095	FC5	SOFTWARE	A 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8393 , ASN A:188 , ARG A:190	BINDING SITE FOR RESIDUE MG 0 8067
096	FC6	SOFTWARE	A 0:2569 , HOH 0:4355 , HOH 0:5413 , HOH 0:8453 , HOH E:920 , HOH E:6236	BINDING SITE FOR RESIDUE MG 0 8068
097	FC7	SOFTWARE	A 0:166 , G 0:219 , HOH 0:4418 , HOH 0:5545 , HOH 0:6160 , HOH 0:9749	BINDING SITE FOR RESIDUE MG 0 8070
098	FC8	SOFTWARE	U 0:954 , C 0:2298 , HOH 0:3842 , HOH 0:4596 , HOH 0:8455	BINDING SITE FOR RESIDUE MG 0 8072
099	FC9	SOFTWARE	A 0:1286 , A 0:1287 , HOH 0:8394 , HOH 0:8395 , HOH W:7873 , HOH W:7874	BINDING SITE FOR RESIDUE MG 0 8074
100	FD1	SOFTWARE	HOH 0:4497 , ILE J:127 , LYS J:128	BINDING SITE FOR RESIDUE CL J 9301
101	FD2	SOFTWARE	PRO J:88 , LYS J:90	BINDING SITE FOR RESIDUE CL J 9302
102	FD3	SOFTWARE	HOH 0:6324 , GLY J:64 , ASN J:65 , GLY J:68 , TYR J:69	BINDING SITE FOR RESIDUE CL J 9321
103	FD4	SOFTWARE	HOH 0:4028 , HOH 0:4840 , HOH 0:6599 , HOH 0:8454 , ASN K:42 , HOH K:2121	BINDING SITE FOR RESIDUE MG K 8069
104	FD5	SOFTWARE	LYS L:52 , ARG L:53	BINDING SITE FOR RESIDUE CL L 9310
105	FD6	SOFTWARE	HOH 0:4259 , HOH 0:9906 , ARG L:27 , GLU L:39 , HOH L:9416 , HOH L:9434 , HOH L:9480 , HOH L:9490	BINDING SITE FOR RESIDUE SR L 9409
106	FD7	SOFTWARE	SER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:9429	BINDING SITE FOR RESIDUE NA M 9147
107	FD8	SOFTWARE	SER M:106 , ARG M:113 , VAL M:114 , ARG M:158 , VAL M:159	BINDING SITE FOR RESIDUE CL M 9318
108	FD9	SOFTWARE	LYS D:146 , ARG N:37 , LYS N:38 , ASN N:107	BINDING SITE FOR RESIDUE CL N 9307
109	GC1	SOFTWARE	A 0:907 , A 0:908 , HOH 0:4241 , HOH 0:4517 , HOH 0:5525 , HOH 0:8396	BINDING SITE FOR RESIDUE MG 0 8075
110	GC2	SOFTWARE	HOH 0:7385 , HOH 0:8403 , HOH 0:8456 , HOH 0:8457	BINDING SITE FOR RESIDUE MG 0 8076
111	GC3	SOFTWARE	A 0:165 , A 0:167 , C 0:168 , HOH 0:4215 , HOH 0:4220 , HOH 0:4232	BINDING SITE FOR RESIDUE MG 0 8079
112	GC4	SOFTWARE	A 0:1684 , U 0:1724 , HOH 0:4805 , HOH 0:7219 , HOH 0:8406	BINDING SITE FOR RESIDUE MG 0 8080
113	GC5	SOFTWARE	A 0:1437 , HOH 0:5738 , HOH 0:5823 , HOH 0:8467	BINDING SITE FOR RESIDUE MG 0 8082
114	GC6	SOFTWARE	C 0:1753 , A 0:1754 , HOH 0:4311 , HOH 0:4752 , HOH 0:8407 , HOH 0:8460	BINDING SITE FOR RESIDUE MG 0 8083
115	GC7	SOFTWARE	A 0:1742 , HOH 0:3369 , HOH 0:4239 , HOH 0:8408 , HOH 0:9877	BINDING SITE FOR RESIDUE MG 0 8084
116	GC8	SOFTWARE	G 0:2618 , HOH 0:4391 , HOH 0:4953 , HOH 0:5078	BINDING SITE FOR RESIDUE MG 0 8085
117	GC9	SOFTWARE	G 0:2540 , G 0:2611 , HOH 0:4892 , NA 0:9139 , HOH 0:9690 , HOH 0:9923	BINDING SITE FOR RESIDUE MG 0 8088
118	GD1	SOFTWARE	HIS O:40 , HOH O:5322 , HOH O:5650	BINDING SITE FOR RESIDUE CD O 9205
119	GD2	SOFTWARE	HOH 0:7555 , ASN O:44	BINDING SITE FOR RESIDUE CL O 9308
120	GD3	SOFTWARE	ASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427	BINDING SITE FOR RESIDUE NA Q 9148
121	GD4	SOFTWARE	HOH 0:4351 , SER R:70 , VAL R:72 , NA R:9138 , HOH R:9436 , HOH R:9468	BINDING SITE FOR RESIDUE NA R 9137
122	GD5	SOFTWARE	U 0:2659 , G 0:2660 , SER R:70 , VAL R:72 , TRP R:75 , NA R:9137 , HOH R:9427 , HOH R:9436	BINDING SITE FOR RESIDUE NA R 9138
123	GD6	SOFTWARE	U 0:12 , LYS R:60 , GLN R:61 , ASN R:63 , SR R:9418	BINDING SITE FOR RESIDUE NA R 9186
124	GD7	SOFTWARE	LYS R:118 , HOH R:9420	BINDING SITE FOR RESIDUE CL R 9306
125	GD8	SOFTWARE	GLN R:61 , ASN R:63 , NA R:9186	BINDING SITE FOR RESIDUE SR R 9418
126	GD9	SOFTWARE	HIS S:7 , GLU S:61 , HOH S:9482	BINDING SITE FOR RESIDUE NA S 9112
127	HC1	SOFTWARE	A 0:516 , U 0:517 , G 0:518 , HOH 0:8411 , HOH 0:8461 , HOH 0:8462	BINDING SITE FOR RESIDUE MG 0 8089
128	HC2	SOFTWARE	A 0:2103 , U 0:2478 , HOH 0:4398	BINDING SITE FOR RESIDUE MG 0 8090
129	HC3	SOFTWARE	G 0:918 , HOH 0:3175 , HOH 0:3930 , HOH 0:7029 , HOH 0:8412 , HOH 0:9719	BINDING SITE FOR RESIDUE MG 0 8091
130	HC4	SOFTWARE	A 0:1843 , C 0:1844 , HOH 0:3013 , HOH 0:8463	BINDING SITE FOR RESIDUE MG 0 8092
131	HC5	SOFTWARE	A 0:1070 , G 0:1071 , HOH 0:3309 , HOH 0:4254 , HOH 0:4286 , HOH 0:4326	BINDING SITE FOR RESIDUE MG 0 8093
132	HC6	SOFTWARE	U 0:1096 , C 0:1257 , G 0:1258 , HOH 0:8413	BINDING SITE FOR RESIDUE MG 0 8094
133	HC7	SOFTWARE	G 0:1848 , G 0:1849 , HOH 0:4267 , HOH 0:4304 , HOH 0:4436 , HOH 0:4467	BINDING SITE FOR RESIDUE MG 0 8096
134	HC8	SOFTWARE	U 0:862 , G 0:863 , HOH 0:3945 , HOH 0:4276 , HOH 0:6122	BINDING SITE FOR RESIDUE MG 0 8097
135	HC9	SOFTWARE	A 0:907 , HOH 0:3559 , HOH 0:3975 , HOH 0:4288 , HOH 0:4350 , HOH Y:9369	BINDING SITE FOR RESIDUE MG 0 8098
136	HD1	SOFTWARE	ASP S:59	BINDING SITE FOR RESIDUE SR S 9470
137	HD2	SOFTWARE	TYR T:35 , GLN T:37 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868	BINDING SITE FOR RESIDUE MG T 8073
138	HD3	SOFTWARE	CYS U:6 , CYS U:9 , CYS U:32 , CYS U:36	BINDING SITE FOR RESIDUE CD U 9201
139	HD4	SOFTWARE	HIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:9362 , HOH Y:9382 , HOH Y:9416	BINDING SITE FOR RESIDUE MG Y 8109
140	HD5	SOFTWARE	ARG Y:169	BINDING SITE FOR RESIDUE CL Y 9320
141	HD6	SOFTWARE	CYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60	BINDING SITE FOR RESIDUE CD Z 9203
142	HD7	SOFTWARE	CYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37	BINDING SITE FOR RESIDUE CD 1 9202
143	HD8	SOFTWARE	U 0:862 , HOH 0:5475 , HOH 0:9795 , LYS 1:10 , ASN 1:12 , HOH 1:9499	BINDING SITE FOR RESIDUE SR 1 9419
144	HD9	SOFTWARE	HOH 0:3839 , HOH 0:4483 , HOH 0:9927 , ASP 1:47 , HOH 1:9473 , HOH 1:9484	BINDING SITE FOR RESIDUE SR 1 9460
145	IC1	SOFTWARE	A 0:2612 , U 0:2648 , HOH 0:3630 , HOH 0:4271 , HOH 0:4283	BINDING SITE FOR RESIDUE MG 0 8099
146	IC2	SOFTWARE	U 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4349 , HOH 0:5211 , HOH 0:7441	BINDING SITE FOR RESIDUE MG 0 8101
147	IC3	SOFTWARE	A 0:2434 , U 0:2458 , HOH 0:8472 , HOH 0:9880 , HOH 3:9449 , HOH 3:9460	BINDING SITE FOR RESIDUE MG 0 8102
148	IC4	SOFTWARE	G 0:2578 , G 0:2579 , HOH 0:8465	BINDING SITE FOR RESIDUE MG 0 8103
149	IC5	SOFTWARE	C 0:2104 , C 0:2105 , HOH 0:8325	BINDING SITE FOR RESIDUE MG 0 8104
150	IC6	SOFTWARE	G 0:817 , HOH 0:4205 , HOH 0:7909 , HOH 0:7914 , MG 0:8043 , HOH 0:8431 , HOH P:185	BINDING SITE FOR RESIDUE MG 0 8106
151	IC7	SOFTWARE	C 0:1104 , A 0:1106 , A 0:1107 , HOH 0:8442 , HOH J:7851	BINDING SITE FOR RESIDUE MG 0 8107
152	IC8	SOFTWARE	HOH 0:6651 , HOH 0:7986 , HOH 0:8443 , HOH 0:8444 , HOH 0:8445	BINDING SITE FOR RESIDUE MG 0 8108
153	IC9	SOFTWARE	U 0:903 , A 0:1357 , HOH 0:3136 , HOH 0:4527 , HOH 0:5978 , HOH 0:6588	BINDING SITE FOR RESIDUE MG 0 8110
154	ID1	SOFTWARE	U 0:392 , HOH 0:3368 , SR 0:9461 , ARG 3:42 , ASN 3:43 , HOH 3:9494	BINDING SITE FOR RESIDUE NA 3 9169
155	ID2	SOFTWARE	CYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74	BINDING SITE FOR RESIDUE CD 3 9204
156	ID3	SOFTWARE	THR 3:65 , ASP 3:66	BINDING SITE FOR RESIDUE CL 3 9304
157	ID4	SOFTWARE	HOH 0:4558 , HOH 0:8458 , GLY 3:45 , GLY 3:47 , ASP 3:49 , HOH M:9448	BINDING SITE FOR RESIDUE SR 3 9439
158	JC1	SOFTWARE	A 0:187 , HOH 0:3198 , HOH 0:4329 , HOH 0:4371 , HOH 0:9754 , HOH 0:9957	BINDING SITE FOR RESIDUE MG 0 8112
159	JC2	SOFTWARE	A 0:2112 , HOH 0:3217 , HOH 0:4356 , HOH 0:4525 , HOH 0:6684 , HOH 0:6945	BINDING SITE FOR RESIDUE MG 0 8113
160	JC3	SOFTWARE	A 0:2430 , HOH 0:3079 , HOH 0:4566 , HOH 0:5409 , HOH 0:9974	BINDING SITE FOR RESIDUE MG 0 8114
161	JC4	SOFTWARE	HOH 0:4885 , HOH 0:4900 , HOH 0:7144 , MG 0:8116 , HOH A:9539 , HOH A:9617	BINDING SITE FOR RESIDUE MG 0 8115
162	JC5	SOFTWARE	U 0:1850 , HOH 0:4267 , HOH 0:4292 , HOH 0:4467 , HOH 0:7271 , MG 0:8115 , HOH A:9539	BINDING SITE FOR RESIDUE MG 0 8116
163	JC6	SOFTWARE	A 0:1840 , C 0:1841 , A 0:2022 , HOH 0:5226 , HOH 0:7105 , HOH 0:9854	BINDING SITE FOR RESIDUE MG 0 8117
164	JC7	SOFTWARE	G 0:2102 , G 0:2482 , C 0:2536	BINDING SITE FOR RESIDUE K 0 9001
165	JC8	SOFTWARE	C 0:162 , U 0:163 , U 0:172 , HOH 0:9642 , HOH 0:9738 , ARG M:82 , HOH M:9324	BINDING SITE FOR RESIDUE K 0 9002
166	JC9	SOFTWARE	C 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3810 , HOH 0:5557	BINDING SITE FOR RESIDUE NA 0 9101
167	KC1	SOFTWARE	G 0:1119 , U 0:1120 , G 0:1121 , HOH 0:8356	BINDING SITE FOR RESIDUE NA 0 9102
168	KC2	SOFTWARE	A 0:630 , A 0:631 , A 0:2074 , HOH 0:4690 , HOH 0:5292 , HOH 0:6352	BINDING SITE FOR RESIDUE NA 0 9105
169	KC3	SOFTWARE	G 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9753	BINDING SITE FOR RESIDUE NA 0 9106
170	KC4	SOFTWARE	C 0:40 , G 0:41 , A 0:442 , C 0:443	BINDING SITE FOR RESIDUE NA 0 9107
171	KC5	SOFTWARE	C 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4018 , SR 0:9473	BINDING SITE FOR RESIDUE NA 0 9108
172	KC6	SOFTWARE	A 0:2577 , G 0:2578 , G 0:2579 , HOH 0:5098	BINDING SITE FOR RESIDUE NA 0 9110
173	KC7	SOFTWARE	C 0:2493 , U 0:2523 , G 0:2524 , G 0:2525 , HOH 0:4182 , HOH 0:5243	BINDING SITE FOR RESIDUE NA 0 9111
174	KC8	SOFTWARE	G 0:2399 , HOH 0:3569 , HOH 0:4437 , HOH 0:5654 , HOH 0:5701	BINDING SITE FOR RESIDUE NA 0 9113
175	KC9	SOFTWARE	U 0:2541 , U 0:2607 , HOH 0:3743 , HOH 0:9958 , TRP B:242	BINDING SITE FOR RESIDUE NA 0 9114
176	LC1	SOFTWARE	A 0:165 , A 0:166 , A 0:167 , HOH 0:3312	BINDING SITE FOR RESIDUE NA 0 9115
177	LC2	SOFTWARE	C 0:896 , A 0:897 , HOH 0:6865 , HOH 0:8258	BINDING SITE FOR RESIDUE NA 0 9116
178	LC3	SOFTWARE	G 0:1416 , G 0:1417 , HOH 0:5737 , HOH 0:9903 , TRP 2:42 , ASN 2:45	BINDING SITE FOR RESIDUE NA 0 9117
179	LC4	SOFTWARE	G 0:2544 , U 0:2545 , HOH 0:3022 , HOH 0:4531 , HOH 0:7998 , HOH 0:8485 , NA 0:9120	BINDING SITE FOR RESIDUE NA 0 9118
180	LC5	SOFTWARE	G 0:2543 , G 0:2544 , U 0:2615 , HOH 0:3361 , HOH 0:8485 , NA 0:9118	BINDING SITE FOR RESIDUE NA 0 9120
181	LC6	SOFTWARE	C 0:2287 , ARG H:114	BINDING SITE FOR RESIDUE NA 0 9122
182	LC7	SOFTWARE	G 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:5072	BINDING SITE FOR RESIDUE NA 0 9123
183	LC8	SOFTWARE	C 0:130 , U 0:146 , G 0:147 , HOH 0:3121 , HOH 0:7670	BINDING SITE FOR RESIDUE NA 0 9124
184	LC9	SOFTWARE	A 0:776 , U 0:777 , U 0:779 , HOH 0:3253 , HOH 0:3885 , HOH 0:8232 , SR 0:9441	BINDING SITE FOR RESIDUE NA 0 9125
185	MC1	SOFTWARE	G 0:1971 , G 0:2009 , A 0:2010 , U 0:2012 , HOH 0:3208	BINDING SITE FOR RESIDUE NA 0 9126
186	MC2	SOFTWARE	U 0:821 , C 0:822 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3814	BINDING SITE FOR RESIDUE NA 0 9127
187	MC3	SOFTWARE	G 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5795 , HOH 0:7024	BINDING SITE FOR RESIDUE NA 0 9128
188	MC4	SOFTWARE	G 0:66 , U 0:107 , U 0:108 , HOH 0:7123	BINDING SITE FOR RESIDUE NA 0 9129
189	MC5	SOFTWARE	G 0:140 , C 0:141 , G 0:142 , HOH 0:9863	BINDING SITE FOR RESIDUE NA 0 9130
190	MC6	SOFTWARE	U 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:3179 , HOH 0:9926	BINDING SITE FOR RESIDUE NA 0 9131
191	MC7	SOFTWARE	G 0:386 , G 0:387 , G 0:388 , U 0:402	BINDING SITE FOR RESIDUE NA 0 9132
192	MC8	SOFTWARE	C 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5829 , HOH 0:8475	BINDING SITE FOR RESIDUE NA 0 9134
193	MC9	SOFTWARE	C 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3487	BINDING SITE FOR RESIDUE NA 0 9135
194	NC1	SOFTWARE	G 0:1706 , G 0:1707 , HOH 0:3541 , HOH 0:5919 , HOH 0:7851 , HOH 0:8261	BINDING SITE FOR RESIDUE NA 0 9136
195	NC2	SOFTWARE	G 0:2540 , G 0:2611 , G 0:2616 , HOH 0:3642 , HOH 0:4892 , MG 0:8088	BINDING SITE FOR RESIDUE NA 0 9139
196	NC3	SOFTWARE	U 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3650 , HOH 0:6829 , HOH 0:7353	BINDING SITE FOR RESIDUE NA 0 9140
197	NC4	SOFTWARE	G 0:681 , A 0:682 , G 0:683 , HOH 0:4620 , HOH 0:8468	BINDING SITE FOR RESIDUE NA 0 9141
198	NC5	SOFTWARE	U 0:308 , U 0:335 , A 0:339 , C 0:342 , HOH 0:3499 , SER T:94 , ASN T:95	BINDING SITE FOR RESIDUE NA 0 9143
199	NC6	SOFTWARE	A 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045 , HOH 0:6157	BINDING SITE FOR RESIDUE NA 0 9149
200	NC7	SOFTWARE	U 0:623 , U 0:624 , G 0:901 , HOH 0:7487	BINDING SITE FOR RESIDUE NA 0 9150
201	NC8	SOFTWARE	A 0:955 , HOH 0:7148 , C 9:3081 , U 9:3082	BINDING SITE FOR RESIDUE NA 0 9152
202	NC9	SOFTWARE	U 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5410	BINDING SITE FOR RESIDUE NA 0 9154
203	OC1	SOFTWARE	G 0:1119 , C 0:1243 , HOH 0:5402 , THR J:47	BINDING SITE FOR RESIDUE NA 0 9155
204	OC2	SOFTWARE	C 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:3082	BINDING SITE FOR RESIDUE NA 0 9156
205	OC3	SOFTWARE	G 0:941 , U 0:942 , G 0:1024 , HOH 0:6828	BINDING SITE FOR RESIDUE NA 0 9157
206	OC4	SOFTWARE	G 0:2611 , HOH 0:3113 , MG 0:8009 , HOH 0:8354 , HOH 0:9960 , TRP B:242	BINDING SITE FOR RESIDUE NA 0 9158
207	OC5	SOFTWARE	G 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109	BINDING SITE FOR RESIDUE NA 0 9159
208	OC6	SOFTWARE	A 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6513	BINDING SITE FOR RESIDUE NA 0 9160
209	OC7	SOFTWARE	U 0:837 , HOH 0:5681 , HOH 0:7354 , GLN B:230	BINDING SITE FOR RESIDUE NA 0 9161
210	OC8	SOFTWARE	A 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277	BINDING SITE FOR RESIDUE NA 0 9162
211	OC9	SOFTWARE	U 0:1359 , C 0:1360 , HOH 0:4084 , HOH 0:7570	BINDING SITE FOR RESIDUE NA 0 9163
212	PC1	SOFTWARE	U 0:2057 , G 0:2058 , HOH 0:3433	BINDING SITE FOR RESIDUE NA 0 9164
213	PC2	SOFTWARE	U 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , ALA M:194	BINDING SITE FOR RESIDUE NA 0 9165
214	PC3	SOFTWARE	G 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3501 , HOH 0:4423 , HOH 0:4482	BINDING SITE FOR RESIDUE NA 0 9166
215	PC4	SOFTWARE	G 0:464 , G 0:475 , HOH 0:3445 , HOH 0:5071 , HOH 0:5194 , ARG C:55	BINDING SITE FOR RESIDUE NA 0 9167
216	PC5	SOFTWARE	G 0:798 , G 0:814 , U 0:815	BINDING SITE FOR RESIDUE NA 0 9168
217	PC6	SOFTWARE	U 0:1831 , HOH 0:4378 , HOH 0:4703 , HOH 0:9731	BINDING SITE FOR RESIDUE NA 0 9170
218	PC7	SOFTWARE	G 0:2491 , U 0:2492 , G 0:2529	BINDING SITE FOR RESIDUE NA 0 9171
219	PC8	SOFTWARE	U 0:919 , G 0:921 , G 0:924 , HOH 0:9899	BINDING SITE FOR RESIDUE NA 0 9172
220	PC9	SOFTWARE	G 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:4284 , HOH 0:7807	BINDING SITE FOR RESIDUE NA 0 9173
221	QC1	SOFTWARE	C 0:195 , G 0:196 , A 0:415 , G 0:416 , HOH 0:3512	BINDING SITE FOR RESIDUE NA 0 9174
222	QC2	SOFTWARE	G 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9891	BINDING SITE FOR RESIDUE NA 0 9175
223	QC3	SOFTWARE	G 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:6892	BINDING SITE FOR RESIDUE NA 0 9177
224	QC4	SOFTWARE	C 0:762 , G 0:902 , U 0:903 , HOH 0:3818 , HIS L:18 , HOH L:9428 , HOH L:9447	BINDING SITE FOR RESIDUE NA 0 9178
225	QC5	SOFTWARE	U 0:831 , U 0:832 , G 0:833 , HOH 0:4317 , HOH 0:5020 , HOH 0:5595	BINDING SITE FOR RESIDUE NA 0 9179
226	QC6	SOFTWARE	G 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4294 , HOH 0:7598 , HOH 0:9956	BINDING SITE FOR RESIDUE NA 0 9181
227	QC7	SOFTWARE	G 0:2772 , G 0:2773	BINDING SITE FOR RESIDUE NA 0 9182
228	QC8	SOFTWARE	C 0:197 , HOH 0:5832	BINDING SITE FOR RESIDUE NA 0 9184
229	QC9	SOFTWARE	A 0:1079 , HOH 0:5775 , HOH 0:8254	BINDING SITE FOR RESIDUE NA 0 9185
230	RC1	SOFTWARE	G 0:1452 , G 0:1676 , LYS 2:2	BINDING SITE FOR RESIDUE CL 0 9303
231	RC2	SOFTWARE	C 0:197 , G 0:201 , U 0:202	BINDING SITE FOR RESIDUE CL 0 9305
232	RC3	SOFTWARE	C 0:2388 , HOH 0:3776 , PHE Q:52 , HIS Q:53	BINDING SITE FOR RESIDUE CL 0 9311
233	RC4	SOFTWARE	G 0:2582 , A 0:2596 , LYS K:14 , SER K:33 , HOH K:4058	BINDING SITE FOR RESIDUE CL 0 9312
234	RC5	SOFTWARE	A 0:1328 , A 0:1329 , HOH 0:5248 , HOH 0:5539	BINDING SITE FOR RESIDUE CL 0 9313
235	RC6	SOFTWARE	G 0:644 , HIS L:13 , HOH L:9488	BINDING SITE FOR RESIDUE CL 0 9314
236	RC7	SOFTWARE	A 0:1597 , A 0:1598 , G 0:1646	BINDING SITE FOR RESIDUE CL 0 9315
237	RC8	SOFTWARE	G 0:1119 , C 0:1243 , LYS J:56	BINDING SITE FOR RESIDUE CL 0 9316
238	RC9	SOFTWARE	C 0:594 , U 0:595 , HOH Y:9356	BINDING SITE FOR RESIDUE CL 0 9317
239	SC1	SOFTWARE	G 0:1072 , G 0:1087 , A 0:1291	BINDING SITE FOR RESIDUE CL 0 9322
240	SC2	SOFTWARE	G 0:824 , G 0:854 , HOH 0:4559 , HOH 0:4890 , HOH 0:5123	BINDING SITE FOR RESIDUE SR 0 9405
241	SC3	SOFTWARE	G 0:836 , U 0:2615 , HOH 0:4441 , HOH 0:9987 , GLN B:230 , HOH B:9526	BINDING SITE FOR RESIDUE SR 0 9406
242	SC4	SOFTWARE	G 0:1489 , G 0:1491 , HOH 0:3024 , HOH 0:4236 , HOH 0:4557 , HOH 0:6726	BINDING SITE FOR RESIDUE SR 0 9407
243	SC5	SOFTWARE	U 0:832 , A 0:1839 , A 0:1840 , HOH 0:3963 , HOH 0:8334 , HOH 0:9635 , HOH 0:9728	BINDING SITE FOR RESIDUE SR 0 9408
244	SC6	SOFTWARE	A 0:643 , C 0:1353 , G 0:1354 , HOH 0:3060 , HOH 0:7125 , HOH 0:8478	BINDING SITE FOR RESIDUE SR 0 9410
245	SC7	SOFTWARE	A 0:1754 , A 0:1755 , HOH 0:7133 , HOH 0:7683 , HOH 0:8165	BINDING SITE FOR RESIDUE SR 0 9411
246	SC8	SOFTWARE	C 0:893 , HOH 0:6194 , HOH 0:8477 , HOH C:9149	BINDING SITE FOR RESIDUE SR 0 9412
247	SC9	SOFTWARE	G 0:1055 , HOH 0:4429 , HOH 0:5419 , HOH 0:6881 , ASP H:10 , HOH H:9506	BINDING SITE FOR RESIDUE SR 0 9413
248	TC1	SOFTWARE	U 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:9444	BINDING SITE FOR RESIDUE SR 0 9414
249	TC2	SOFTWARE	HOH 0:4370 , HOH 0:6078 , HOH 0:6708 , HOH 0:7137 , HOH 0:7425 , HOH 0:8414 , HOH 0:8415	BINDING SITE FOR RESIDUE SR 0 9415
250	TC3	SOFTWARE	A 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3302 , HOH 0:4417	BINDING SITE FOR RESIDUE SR 0 9416
251	TC4	SOFTWARE	C 0:85 , A 0:86 , C 0:87 , HOH 0:5934 , ASP T:68	BINDING SITE FOR RESIDUE SR 0 9417
252	TC5	SOFTWARE	HOH 0:4750 , HOH 0:5471 , HOH 0:5800	BINDING SITE FOR RESIDUE SR 0 9420
253	TC6	SOFTWARE	U 0:664 , G 0:681 , HOH 0:7461 , HOH C:9144	BINDING SITE FOR RESIDUE SR 0 9421
254	TC7	SOFTWARE	C 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4699 , HOH 0:6013 , HOH 0:6337	BINDING SITE FOR RESIDUE SR 0 9422
255	TC8	SOFTWARE	U 0:454 , C 0:478 , HOH 0:4820 , HOH 0:6213 , HOH 0:6700	BINDING SITE FOR RESIDUE SR 0 9423
256	TC9	SOFTWARE	A 0:1504 , A 0:1678 , C 0:1679 , HOH 0:8347 , HOH 0:8348 , HOH 0:8364	BINDING SITE FOR RESIDUE SR 0 9424
257	UC1	SOFTWARE	G 0:2543 , C 0:2608 , C 4:74	BINDING SITE FOR RESIDUE SR 0 9425
258	UC2	SOFTWARE	G 0:2632 , HOH 0:3905 , HOH 0:5137 , HOH 0:6053	BINDING SITE FOR RESIDUE SR 0 9426
259	UC3	SOFTWARE	A 0:1717 , G 0:1718 , HOH 0:5146 , HOH 0:5923 , HOH 0:6931	BINDING SITE FOR RESIDUE SR 0 9427
260	UC4	SOFTWARE	G 0:471 , HOH 0:3653 , HOH 0:4994 , HOH 0:6183 , HOH 0:8011 , HOH 0:9832 , HOH 0:9870	BINDING SITE FOR RESIDUE SR 0 9428
261	UC5	SOFTWARE	G 0:1059 , C 0:1127 , HOH 0:4425 , HOH 0:5896 , HOH 0:9742	BINDING SITE FOR RESIDUE SR 0 9429
262	UC6	SOFTWARE	A 0:639 , G 0:640 , HOH 0:3257 , HOH 0:3517 , HOH 0:4586 , HOH 0:5411 , HOH 0:6604	BINDING SITE FOR RESIDUE SR 0 9430
263	UC7	SOFTWARE	G 0:2725 , G 0:2755 , HOH 0:3879 , HOH 0:4416 , HOH 0:5647 , HOH 0:6890 , HOH 0:7213	BINDING SITE FOR RESIDUE SR 0 9431
264	UC8	SOFTWARE	G 0:503	BINDING SITE FOR RESIDUE SR 0 9432
265	UC9	SOFTWARE	HOH 0:3946 , HOH 0:6348 , HOH 0:6994	BINDING SITE FOR RESIDUE SR 0 9433
266	VC1	SOFTWARE	A 0:2553 , HOH 0:3216 , HOH 0:4252	BINDING SITE FOR RESIDUE SR 0 9434
267	VC2	SOFTWARE	U 0:1109 , G 0:1110 , A 0:1247 , HOH 0:4060 , HOH 0:7497	BINDING SITE FOR RESIDUE SR 0 9435
268	VC3	SOFTWARE	G 0:1543 , HOH 0:5574 , HOH 0:6638 , HOH 0:6650	BINDING SITE FOR RESIDUE SR 0 9438
269	VC4	SOFTWARE	A 0:532 , U 0:533 , HOH 0:4335 , HOH 0:4576 , HOH 0:8409 , HOH 0:8410	BINDING SITE FOR RESIDUE SR 0 9440
270	VC5	SOFTWARE	U 0:777 , U 0:864 , HOH 0:3253 , HOH 0:3885 , HOH 0:4276 , HOH 0:4280 , HOH 0:7969 , MG 0:8031 , NA 0:9125	BINDING SITE FOR RESIDUE SR 0 9441
271	VC6	SOFTWARE	G 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8438 , HOH 0:8439	BINDING SITE FOR RESIDUE SR 0 9442
272	VC7	SOFTWARE	A 0:1291 , G 0:1292 , HOH 0:3830 , HOH 0:4217 , HOH 0:7959 , HOH 0:8419	BINDING SITE FOR RESIDUE SR 0 9443
273	VC8	SOFTWARE	C 0:880 , A 0:882 , U 0:883 , HOH 0:4226 , HOH 0:8404 , HOH 0:8405 , HOH 0:9869	BINDING SITE FOR RESIDUE SR 0 9444
274	VC9	SOFTWARE	HOH 0:4893 , HOH 0:7047 , HOH 0:8118	BINDING SITE FOR RESIDUE SR 0 9445
275	WC1	SOFTWARE	HOH 0:5605 , HOH 0:5762	BINDING SITE FOR RESIDUE SR 0 9446
276	WC2	SOFTWARE	G 0:84 , C 0:85 , HOH 0:5934 , ASP T:68 , HOH T:4745	BINDING SITE FOR RESIDUE SR 0 9447
277	WC3	SOFTWARE	A 0:2465 , G 0:2466 , HOH 0:4860 , HOH 0:8474 , HOH 0:9687 , ASP L:36	BINDING SITE FOR RESIDUE SR 0 9448
278	WC4	SOFTWARE	G 0:1683 , U 0:1696 , HOH 0:3403 , HOH 0:5350 , HOH 0:5431	BINDING SITE FOR RESIDUE SR 0 9449
279	WC5	SOFTWARE	A 0:2746 , G 0:2750 , HOH 0:6440 , HOH 0:6815 , HOH 0:8471	BINDING SITE FOR RESIDUE SR 0 9450
280	WC6	SOFTWARE	A 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6675 , HOH 0:7885	BINDING SITE FOR RESIDUE SR 0 9451
281	WC7	SOFTWARE	U 0:2016 , HOH 0:8147	BINDING SITE FOR RESIDUE SR 0 9452
282	WC8	SOFTWARE	G 0:1484 , HOH 0:4319 , HOH 0:8370 , HOH 0:8425 , HOH 0:8426	BINDING SITE FOR RESIDUE SR 0 9453
283	WC9	SOFTWARE	G 0:2091 , HOH 0:3699 , HOH 0:6659 , HOH 0:7221	BINDING SITE FOR RESIDUE SR 0 9454
284	XC1	SOFTWARE	C 0:1690 , HOH 0:3075 , HOH 0:4346 , HOH 0:4649 , HOH 0:5298	BINDING SITE FOR RESIDUE SR 0 9455
285	XC2	SOFTWARE	A 0:2302 , A 0:2303 , HOH 0:4247 , HOH 0:4373 , HOH 0:5459	BINDING SITE FOR RESIDUE SR 0 9456
286	XC3	SOFTWARE	U 0:821 , C 0:822 , G 0:854 , U 0:855 , HOH 0:3425 , HOH 0:4221 , HOH 0:4357	BINDING SITE FOR RESIDUE SR 0 9457
287	XC4	SOFTWARE	G 0:2696	BINDING SITE FOR RESIDUE SR 0 9459
288	XC5	SOFTWARE	U 0:391 , HOH 0:3640 , HOH 0:6012 , HOH 0:6130 , ARG 3:42 , NA 3:9169	BINDING SITE FOR RESIDUE SR 0 9461
289	XC6	SOFTWARE	G 0:2810 , HOH 0:4646 , HOH 0:8174 , ASN B:27	BINDING SITE FOR RESIDUE SR 0 9462
290	XC7	SOFTWARE	U 0:2557 , HOH 0:3670 , HOH 0:7205	BINDING SITE FOR RESIDUE SR 0 9464
291	XC8	SOFTWARE	A 0:682 , G 0:683 , HOH 0:8468 , HOH 0:8480	BINDING SITE FOR RESIDUE SR 0 9465
292	XC9	SOFTWARE	C 0:1462 , A 0:1463 , GLY 1:40	BINDING SITE FOR RESIDUE SR 0 9466
293	YC1	SOFTWARE	A 0:1133 , G 0:1134 , HOH 0:3056 , HOH 0:4966 , HOH 0:5384	BINDING SITE FOR RESIDUE SR 0 9467
294	YC2	SOFTWARE	U 0:1972 , HOH 0:3296 , HOH 0:3910	BINDING SITE FOR RESIDUE SR 0 9468
295	YC3	SOFTWARE	G 0:1113 , HOH 0:4298 , HOH 0:4308	BINDING SITE FOR RESIDUE SR 0 9469
296	YC4	SOFTWARE	U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4046 , HOH 0:4196 , HOH 0:5259 , NA 0:9108	BINDING SITE FOR RESIDUE SR 0 9473
297	YC5	SOFTWARE	G 0:2284 , HOH 0:6089 , HOH 0:7719	BINDING SITE FOR RESIDUE SR 0 9474
298	YC6	SOFTWARE	G 0:2777 , HOH 0:4798 , HOH 0:7863	BINDING SITE FOR RESIDUE SR 0 9475
299	YC7	SOFTWARE	A 0:1815 , HOH 0:8136 , HOH 0:8398 , HOH 0:8399	BINDING SITE FOR RESIDUE SR 0 9477
300	YC8	SOFTWARE	C 0:235 , HOH 0:5293 , HOH 0:6023 , HOH 0:6709 , HOH 0:8140	BINDING SITE FOR RESIDUE SR 0 9478
301	YC9	SOFTWARE	U 0:2690 , HOH 0:3665 , HOH 0:6105	BINDING SITE FOR RESIDUE SR 0 9480
302	ZC1	SOFTWARE	A 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5467 , GLY L:14 , HOH L:9489	BINDING SITE FOR RESIDUE SR 0 9482
303	ZC2	SOFTWARE	A 0:565 , G 0:592	BINDING SITE FOR RESIDUE SR 0 9483
304	ZC3	SOFTWARE	HOH 0:6159	BINDING SITE FOR RESIDUE SR 0 9484
305	ZC4	SOFTWARE	HOH 0:6998 , HOH 0:7808 , HOH 0:7953	BINDING SITE FOR RESIDUE SR 0 9488
306	ZC5	SOFTWARE	U 0:1835 , HOH 0:3593 , HOH 0:8178	BINDING SITE FOR RESIDUE SR 0 9489
307	ZC6	SOFTWARE	C 0:1894 , U 0:1897 , G 0:1898 , U 0:1939	BINDING SITE FOR RESIDUE SR 0 9490
308	ZC7	SOFTWARE	HOH 0:5143 , HOH 0:6090 , HOH 0:7737	BINDING SITE FOR RESIDUE SR 0 9495
309	ZC8	SOFTWARE	C 0:1129 , HOH 0:4227 , HOH 0:6654 , HOH 0:8450 , C 9:3091 , G 9:3092 , HOH 9:3843	BINDING SITE FOR RESIDUE SR 0 9498
310	ZC9	SOFTWARE	C 0:34 , U 0:457 , HOH 0:4627	BINDING SITE FOR RESIDUE SR 0 9500

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (26, 26)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1vqk 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1vqk11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1vqk100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1vqk101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1vqk 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1vqk21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1vqk200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1vqk201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1vqk 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1vqk31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1vqk300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1vqk 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90

Chain 4 from PDB  Type:DNA/OTHER/PROTEIN/RNA  Length:5
                                      
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                1vqk 4   74 CCAFx   78
                                |
                               78-ACA

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1vqk 9 3001 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC 3122
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100      3110      3120

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1vqka2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1vqka1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1vqkA01 A:1-78 Nucleic acid-binding proteins                                  ---1vqkA02 A:82-159  [code=2.30.30.30, no name defined]                          1vqkA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1vqkA02 A:10-82                                             -----Ribosomal_L2_C-1vqkA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeee..........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1vqkb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1vqkB01 B:1-38,B:207-257              1vqkB02 B:39-77,B:189-206,B:258-337    1vqkB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1vqkB02           1vqkB01 B:1-38,B:207-257                           1vqkB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1vqkB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.ee..........eeeeeee..eeeeehhhhhhh....hhhhhh.........................eeee..eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1vqkc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1vqkC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1vqkC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhhh..ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqk C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1vqkd1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1vqkD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1vqkD0     1 D:11-64                     ---Ribosomal_L5_C-1vqkD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhh....eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee..hhhhhh..............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1vqke1 E:1-79 Ribosomal protein L6                                            d1vqke2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1vqkE01 E:1-79  [code=3.90.930.12, no name defined]                            1vqkE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqkE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1vqkE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeeee..eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1vqkf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1vqkF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1vqkF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh.eeeehhhhhhhhhhhh....eeee....hhhhh.hhhhhhhh....eeee.hhhhhhhhh.......eeeee....hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1vqkg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1vqk G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1vqkh1 H:1-163 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1vqkH00 H:1-171  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee....hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk H    1 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA  171
                                    10        20        30        40        50        60        70        80        90        |-         -|      120       130       140       150       160       170 
                                                                                                                             99         111

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1vqki1 I:71-140 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1vqkI00 I:71-140  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1vqkI01 I:71-139                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhh..............eeeehhhhhhhhhhh.......hhhhhhhhhhhhhh...eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1vqk I   71 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  140
                                    80        90       100       110       120       130       140

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1vqkj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1vqkJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1vqkJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1vqkk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1vqkK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1vqkK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee..............eehhhhhhhhhhhh....ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqk K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1vqkl1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1vqkL01 L:1-50                                    1vqkL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1vqkL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author .hhhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqk L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1vqkm1 M:1-194 Ribosomal protein L15e                                                                                                                                                             SCOP domains
               CATH domains 1vqkM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1vqkM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ..hhhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhhh........hhhhhhhhhhhhhh...eeeeeeeeeee..eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1vqkn1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1vqkN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1vqkN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqk N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1vqko1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1vqkO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1vqkO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1vqkp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1vqkP01 P:1-55  [code=1.10.1650.10, no name defined]   1vqkP02 P:56-88 Single Heli x bin1vqkP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1vqkq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1vqkQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1vqkQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhhh......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1vqk Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1vqkr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1vqkR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1vqkR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1vqk R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1vqks1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1vqkS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1vqkS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1vqk S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1vqkt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1vqkT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1vqkT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1vqku1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1vqkU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1vqkU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1vqk U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1vqkv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1vqkV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1vqkV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1vqk V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1vqkw1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1vqkW01 W:1-57,W:114-154                                 1vqkW02 W:58-113  [code=1.10.15.30, no name defined]    1vqkW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1vqkW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1vqkx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1vqkX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1vqkX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1vqk X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1vqky1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1vqkY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh.......hhhhh............................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1vqk Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1vqkz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1vqkZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1vqkZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhh..ee......eeeeeee..eeee.....eee.........hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1vqk Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (30, 31)

CATH Domains (32, 36)

Pfam Domains (26, 28)

Gene Ontology (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)

Chain 1 (RL37_HALMA | P32410)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2 (RL39_HALMA | P22452)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3 (RL44E_HALMA | P32411)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A (RL2_HALMA | P20276)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B (RL3_HALMA | P20279)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C (RL4_HALMA | P12735)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D (RL5_HALMA | P14124)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E (RL6_HALMA | P14135)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F (RL7A_HALMA | P12743)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0004526	ribonuclease P activity	Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0090501	RNA phosphodiester bond hydrolysis	The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0001682	tRNA 5'-leader removal	Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G (RL10_HALMA | P15825)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
biological process
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H (RL10E_HALMA | P60617)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I (RL11_HALMA | P14122)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J (RL13_HALMA | P29198)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K (RL14_HALMA | P22450)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L (RL15_HALMA | P12737)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M (RL15E_HALMA | P60618)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N (RL18_HALMA | P14123)

molecular function
	GO:0008097	5S rRNA binding	Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O (RL18E_HALMA | P12733)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P (RL19E_HALMA | P14119)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q (RL21_HALMA | P12734)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R (RL22_HALMA | P10970)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S (RL23_HALMA | P12732)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T (RL24_HALMA | P10972)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U (RL24E_HALMA | P14116)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V (RL29_HALMA | P10971)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W (RL30_HALMA | P14121)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X (RL31_HALMA | P18138)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y (RL32_HALMA | P12736)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z (RL37A_HALMA | P60619)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		1MA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OMG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OMU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PSU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UR3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		BD1	[ RasMol ]	+environment [ RasMol ]
		BD2	[ RasMol ]	+environment [ RasMol ]
		BD3	[ RasMol ]	+environment [ RasMol ]
		BD4	[ RasMol ]	+environment [ RasMol ]
		BD5	[ RasMol ]	+environment [ RasMol ]
		BD6	[ RasMol ]	+environment [ RasMol ]
		BD7	[ RasMol ]	+environment [ RasMol ]
		BD8	[ RasMol ]	+environment [ RasMol ]
		BD9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]
		CC3	[ RasMol ]	+environment [ RasMol ]
		CC4	[ RasMol ]	+environment [ RasMol ]
		CC5	[ RasMol ]	+environment [ RasMol ]
		CC6	[ RasMol ]	+environment [ RasMol ]
		CC7	[ RasMol ]	+environment [ RasMol ]
		CC8	[ RasMol ]	+environment [ RasMol ]
		CC9	[ RasMol ]	+environment [ RasMol ]
		CD1	[ RasMol ]	+environment [ RasMol ]
		CD2	[ RasMol ]	+environment [ RasMol ]
		CD3	[ RasMol ]	+environment [ RasMol ]
		CD4	[ RasMol ]	+environment [ RasMol ]
		CD5	[ RasMol ]	+environment [ RasMol ]
		CD6	[ RasMol ]	+environment [ RasMol ]
		CD7	[ RasMol ]	+environment [ RasMol ]
		CD8	[ RasMol ]	+environment [ RasMol ]
		CD9	[ RasMol ]	+environment [ RasMol ]
		DC1	[ RasMol ]	+environment [ RasMol ]
		DC2	[ RasMol ]	+environment [ RasMol ]
		DC3	[ RasMol ]	+environment [ RasMol ]
		DC4	[ RasMol ]	+environment [ RasMol ]
		DC5	[ RasMol ]	+environment [ RasMol ]
		DC6	[ RasMol ]	+environment [ RasMol ]
		DC7	[ RasMol ]	+environment [ RasMol ]
		DC8	[ RasMol ]	+environment [ RasMol ]
		DC9	[ RasMol ]	+environment [ RasMol ]
		DD1	[ RasMol ]	+environment [ RasMol ]
		DD2	[ RasMol ]	+environment [ RasMol ]
		DD3	[ RasMol ]	+environment [ RasMol ]
		DD4	[ RasMol ]	+environment [ RasMol ]
		DD5	[ RasMol ]	+environment [ RasMol ]
		DD6	[ RasMol ]	+environment [ RasMol ]
		DD7	[ RasMol ]	+environment [ RasMol ]
		DD8	[ RasMol ]	+environment [ RasMol ]
		DD9	[ RasMol ]	+environment [ RasMol ]
		EC1	[ RasMol ]	+environment [ RasMol ]
		EC2	[ RasMol ]	+environment [ RasMol ]
		EC3	[ RasMol ]	+environment [ RasMol ]
		EC4	[ RasMol ]	+environment [ RasMol ]
		EC5	[ RasMol ]	+environment [ RasMol ]
		EC6	[ RasMol ]	+environment [ RasMol ]
		EC7	[ RasMol ]	+environment [ RasMol ]
		EC8	[ RasMol ]	+environment [ RasMol ]
		EC9	[ RasMol ]	+environment [ RasMol ]
		ED1	[ RasMol ]	+environment [ RasMol ]
		ED2	[ RasMol ]	+environment [ RasMol ]
		ED3	[ RasMol ]	+environment [ RasMol ]
		ED4	[ RasMol ]	+environment [ RasMol ]
		ED5	[ RasMol ]	+environment [ RasMol ]
		ED6	[ RasMol ]	+environment [ RasMol ]
		ED7	[ RasMol ]	+environment [ RasMol ]
		ED8	[ RasMol ]	+environment [ RasMol ]
		ED9	[ RasMol ]	+environment [ RasMol ]
		FC1	[ RasMol ]	+environment [ RasMol ]
		FC2	[ RasMol ]	+environment [ RasMol ]
		FC3	[ RasMol ]	+environment [ RasMol ]
		FC4	[ RasMol ]	+environment [ RasMol ]
		FC5	[ RasMol ]	+environment [ RasMol ]
		FC6	[ RasMol ]	+environment [ RasMol ]
		FC7	[ RasMol ]	+environment [ RasMol ]
		FC8	[ RasMol ]	+environment [ RasMol ]
		FC9	[ RasMol ]	+environment [ RasMol ]
		FD1	[ RasMol ]	+environment [ RasMol ]
		FD2	[ RasMol ]	+environment [ RasMol ]
		FD3	[ RasMol ]	+environment [ RasMol ]
		FD4	[ RasMol ]	+environment [ RasMol ]
		FD5	[ RasMol ]	+environment [ RasMol ]
		FD6	[ RasMol ]	+environment [ RasMol ]
		FD7	[ RasMol ]	+environment [ RasMol ]
		FD8	[ RasMol ]	+environment [ RasMol ]
		FD9	[ RasMol ]	+environment [ RasMol ]
		GC1	[ RasMol ]	+environment [ RasMol ]
		GC2	[ RasMol ]	+environment [ RasMol ]
		GC3	[ RasMol ]	+environment [ RasMol ]
		GC4	[ RasMol ]	+environment [ RasMol ]
		GC5	[ RasMol ]	+environment [ RasMol ]
		GC6	[ RasMol ]	+environment [ RasMol ]
		GC7	[ RasMol ]	+environment [ RasMol ]
		GC8	[ RasMol ]	+environment [ RasMol ]
		GC9	[ RasMol ]	+environment [ RasMol ]
		GD1	[ RasMol ]	+environment [ RasMol ]
		GD2	[ RasMol ]	+environment [ RasMol ]
		GD3	[ RasMol ]	+environment [ RasMol ]
		GD4	[ RasMol ]	+environment [ RasMol ]
		GD5	[ RasMol ]	+environment [ RasMol ]
		GD6	[ RasMol ]	+environment [ RasMol ]
		GD7	[ RasMol ]	+environment [ RasMol ]
		GD8	[ RasMol ]	+environment [ RasMol ]
		GD9	[ RasMol ]	+environment [ RasMol ]
		HC1	[ RasMol ]	+environment [ RasMol ]
		HC2	[ RasMol ]	+environment [ RasMol ]
		HC3	[ RasMol ]	+environment [ RasMol ]
		HC4	[ RasMol ]	+environment [ RasMol ]
		HC5	[ RasMol ]	+environment [ RasMol ]
		HC6	[ RasMol ]	+environment [ RasMol ]
		HC7	[ RasMol ]	+environment [ RasMol ]
		HC8	[ RasMol ]	+environment [ RasMol ]
		HC9	[ RasMol ]	+environment [ RasMol ]
		HD1	[ RasMol ]	+environment [ RasMol ]
		HD2	[ RasMol ]	+environment [ RasMol ]
		HD3	[ RasMol ]	+environment [ RasMol ]
		HD4	[ RasMol ]	+environment [ RasMol ]
		HD5	[ RasMol ]	+environment [ RasMol ]
		HD6	[ RasMol ]	+environment [ RasMol ]
		HD7	[ RasMol ]	+environment [ RasMol ]
		HD8	[ RasMol ]	+environment [ RasMol ]
		HD9	[ RasMol ]	+environment [ RasMol ]
		IC1	[ RasMol ]	+environment [ RasMol ]
		IC2	[ RasMol ]	+environment [ RasMol ]
		IC3	[ RasMol ]	+environment [ RasMol ]
		IC4	[ RasMol ]	+environment [ RasMol ]
		IC5	[ RasMol ]	+environment [ RasMol ]
		IC6	[ RasMol ]	+environment [ RasMol ]
		IC7	[ RasMol ]	+environment [ RasMol ]
		IC8	[ RasMol ]	+environment [ RasMol ]
		IC9	[ RasMol ]	+environment [ RasMol ]
		ID1	[ RasMol ]	+environment [ RasMol ]
		ID2	[ RasMol ]	+environment [ RasMol ]
		ID3	[ RasMol ]	+environment [ RasMol ]
		ID4	[ RasMol ]	+environment [ RasMol ]
		JC1	[ RasMol ]	+environment [ RasMol ]
		JC2	[ RasMol ]	+environment [ RasMol ]
		JC3	[ RasMol ]	+environment [ RasMol ]
		JC4	[ RasMol ]	+environment [ RasMol ]
		JC5	[ RasMol ]	+environment [ RasMol ]
		JC6	[ RasMol ]	+environment [ RasMol ]
		JC7	[ RasMol ]	+environment [ RasMol ]
		JC8	[ RasMol ]	+environment [ RasMol ]
		JC9	[ RasMol ]	+environment [ RasMol ]
		KC1	[ RasMol ]	+environment [ RasMol ]
		KC2	[ RasMol ]	+environment [ RasMol ]
		KC3	[ RasMol ]	+environment [ RasMol ]
		KC4	[ RasMol ]	+environment [ RasMol ]
		KC5	[ RasMol ]	+environment [ RasMol ]
		KC6	[ RasMol ]	+environment [ RasMol ]
		KC7	[ RasMol ]	+environment [ RasMol ]
		KC8	[ RasMol ]	+environment [ RasMol ]
		KC9	[ RasMol ]	+environment [ RasMol ]
		LC1	[ RasMol ]	+environment [ RasMol ]
		LC2	[ RasMol ]	+environment [ RasMol ]
		LC3	[ RasMol ]	+environment [ RasMol ]
		LC4	[ RasMol ]	+environment [ RasMol ]
		LC5	[ RasMol ]	+environment [ RasMol ]
		LC6	[ RasMol ]	+environment [ RasMol ]
		LC7	[ RasMol ]	+environment [ RasMol ]
		LC8	[ RasMol ]	+environment [ RasMol ]
		LC9	[ RasMol ]	+environment [ RasMol ]
		MC1	[ RasMol ]	+environment [ RasMol ]
		MC2	[ RasMol ]	+environment [ RasMol ]
		MC3	[ RasMol ]	+environment [ RasMol ]
		MC4	[ RasMol ]	+environment [ RasMol ]
		MC5	[ RasMol ]	+environment [ RasMol ]
		MC6	[ RasMol ]	+environment [ RasMol ]
		MC7	[ RasMol ]	+environment [ RasMol ]
		MC8	[ RasMol ]	+environment [ RasMol ]
		MC9	[ RasMol ]	+environment [ RasMol ]
		NC1	[ RasMol ]	+environment [ RasMol ]
		NC2	[ RasMol ]	+environment [ RasMol ]
		NC3	[ RasMol ]	+environment [ RasMol ]
		NC4	[ RasMol ]	+environment [ RasMol ]
		NC5	[ RasMol ]	+environment [ RasMol ]
		NC6	[ RasMol ]	+environment [ RasMol ]
		NC7	[ RasMol ]	+environment [ RasMol ]
		NC8	[ RasMol ]	+environment [ RasMol ]
		NC9	[ RasMol ]	+environment [ RasMol ]
		OC1	[ RasMol ]	+environment [ RasMol ]
		OC2	[ RasMol ]	+environment [ RasMol ]
		OC3	[ RasMol ]	+environment [ RasMol ]
		OC4	[ RasMol ]	+environment [ RasMol ]
		OC5	[ RasMol ]	+environment [ RasMol ]
		OC6	[ RasMol ]	+environment [ RasMol ]
		OC7	[ RasMol ]	+environment [ RasMol ]
		OC8	[ RasMol ]	+environment [ RasMol ]
		OC9	[ RasMol ]	+environment [ RasMol ]
		PC1	[ RasMol ]	+environment [ RasMol ]
		PC2	[ RasMol ]	+environment [ RasMol ]
		PC3	[ RasMol ]	+environment [ RasMol ]
		PC4	[ RasMol ]	+environment [ RasMol ]
		PC5	[ RasMol ]	+environment [ RasMol ]
		PC6	[ RasMol ]	+environment [ RasMol ]
		PC7	[ RasMol ]	+environment [ RasMol ]
		PC8	[ RasMol ]	+environment [ RasMol ]
		PC9	[ RasMol ]	+environment [ RasMol ]
		QC1	[ RasMol ]	+environment [ RasMol ]
		QC2	[ RasMol ]	+environment [ RasMol ]
		QC3	[ RasMol ]	+environment [ RasMol ]
		QC4	[ RasMol ]	+environment [ RasMol ]
		QC5	[ RasMol ]	+environment [ RasMol ]
		QC6	[ RasMol ]	+environment [ RasMol ]
		QC7	[ RasMol ]	+environment [ RasMol ]
		QC8	[ RasMol ]	+environment [ RasMol ]
		QC9	[ RasMol ]	+environment [ RasMol ]
		RC1	[ RasMol ]	+environment [ RasMol ]
		RC2	[ RasMol ]	+environment [ RasMol ]
		RC3	[ RasMol ]	+environment [ RasMol ]
		RC4	[ RasMol ]	+environment [ RasMol ]
		RC5	[ RasMol ]	+environment [ RasMol ]
		RC6	[ RasMol ]	+environment [ RasMol ]
		RC7	[ RasMol ]	+environment [ RasMol ]
		RC8	[ RasMol ]	+environment [ RasMol ]
		RC9	[ RasMol ]	+environment [ RasMol ]
		SC1	[ RasMol ]	+environment [ RasMol ]
		SC2	[ RasMol ]	+environment [ RasMol ]
		SC3	[ RasMol ]	+environment [ RasMol ]
		SC4	[ RasMol ]	+environment [ RasMol ]
		SC5	[ RasMol ]	+environment [ RasMol ]
		SC6	[ RasMol ]	+environment [ RasMol ]
		SC7	[ RasMol ]	+environment [ RasMol ]
		SC8	[ RasMol ]	+environment [ RasMol ]
		SC9	[ RasMol ]	+environment [ RasMol ]
		TC1	[ RasMol ]	+environment [ RasMol ]
		TC2	[ RasMol ]	+environment [ RasMol ]
		TC3	[ RasMol ]	+environment [ RasMol ]
		TC4	[ RasMol ]	+environment [ RasMol ]
		TC5	[ RasMol ]	+environment [ RasMol ]
		TC6	[ RasMol ]	+environment [ RasMol ]
		TC7	[ RasMol ]	+environment [ RasMol ]
		TC8	[ RasMol ]	+environment [ RasMol ]
		TC9	[ RasMol ]	+environment [ RasMol ]
		UC1	[ RasMol ]	+environment [ RasMol ]
		UC2	[ RasMol ]	+environment [ RasMol ]
		UC3	[ RasMol ]	+environment [ RasMol ]
		UC4	[ RasMol ]	+environment [ RasMol ]
		UC5	[ RasMol ]	+environment [ RasMol ]
		UC6	[ RasMol ]	+environment [ RasMol ]
		UC7	[ RasMol ]	+environment [ RasMol ]
		UC8	[ RasMol ]	+environment [ RasMol ]
		UC9	[ RasMol ]	+environment [ RasMol ]
		VC1	[ RasMol ]	+environment [ RasMol ]
		VC2	[ RasMol ]	+environment [ RasMol ]
		VC3	[ RasMol ]	+environment [ RasMol ]
		VC4	[ RasMol ]	+environment [ RasMol ]
		VC5	[ RasMol ]	+environment [ RasMol ]
		VC6	[ RasMol ]	+environment [ RasMol ]
		VC7	[ RasMol ]	+environment [ RasMol ]
		VC8	[ RasMol ]	+environment [ RasMol ]
		VC9	[ RasMol ]	+environment [ RasMol ]
		WC1	[ RasMol ]	+environment [ RasMol ]
		WC2	[ RasMol ]	+environment [ RasMol ]
		WC3	[ RasMol ]	+environment [ RasMol ]
		WC4	[ RasMol ]	+environment [ RasMol ]
		WC5	[ RasMol ]	+environment [ RasMol ]
		WC6	[ RasMol ]	+environment [ RasMol ]
		WC7	[ RasMol ]	+environment [ RasMol ]
		WC8	[ RasMol ]	+environment [ RasMol ]
		WC9	[ RasMol ]	+environment [ RasMol ]
		XC1	[ RasMol ]	+environment [ RasMol ]
		XC2	[ RasMol ]	+environment [ RasMol ]
		XC3	[ RasMol ]	+environment [ RasMol ]
		XC4	[ RasMol ]	+environment [ RasMol ]
		XC5	[ RasMol ]	+environment [ RasMol ]
		XC6	[ RasMol ]	+environment [ RasMol ]
		XC7	[ RasMol ]	+environment [ RasMol ]
		XC8	[ RasMol ]	+environment [ RasMol ]
		XC9	[ RasMol ]	+environment [ RasMol ]
		YC1	[ RasMol ]	+environment [ RasMol ]
		YC2	[ RasMol ]	+environment [ RasMol ]
		YC3	[ RasMol ]	+environment [ RasMol ]
		YC4	[ RasMol ]	+environment [ RasMol ]
		YC5	[ RasMol ]	+environment [ RasMol ]
		YC6	[ RasMol ]	+environment [ RasMol ]
		YC7	[ RasMol ]	+environment [ RasMol ]
		YC8	[ RasMol ]	+environment [ RasMol ]
		YC9	[ RasMol ]	+environment [ RasMol ]
		ZC1	[ RasMol ]	+environment [ RasMol ]
		ZC2	[ RasMol ]	+environment [ RasMol ]
		ZC3	[ RasMol ]	+environment [ RasMol ]
		ZC4	[ RasMol ]	+environment [ RasMol ]
		ZC5	[ RasMol ]	+environment [ RasMol ]
		ZC6	[ RasMol ]	+environment [ RasMol ]
		ZC7	[ RasMol ]	+environment [ RasMol ]
		ZC8	[ RasMol ]	+environment [ RasMol ]
		ZC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg M:184 - Pro M:185	[ RasMol ]
		Asn B:243 - Pro B:244	[ RasMol ]
		Gln F:55 - Pro F:56	[ RasMol ]
		Gly B:14 - Pro B:15	[ RasMol ]
		Trp A:186 - Pro A:187	[ RasMol ]
		Val C:136 - Pro C:137	[ RasMol ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (12, 317)

Sites (310, 310)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (26, 26)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (30, 31)

CATH Domains (32, 36)

Pfam Domains (26, 28)

Gene Ontology (23, 232)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File