Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF ANISOMYCIN RESISTANT 50S RIBOSOMAL SUBUNIT: 23S RRNA MUTATION G2482A
 
Authors :  G. Blaha, G. Gurel
Date :  26 Feb 08  (Deposition) - 20 May 08  (Release) - 27 May 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.95
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,9
Keywords :  G2482A Mutation, 23S Rrna, Large Ribosomal Subunit, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Blaha, G. Gurel, S. J. Schroeder, P. B. Moore, T. A. Steitz
Mutations Outside The Anisomycin-Binding Site Can Make Ribosomes Drug-Resistant.
J. Mol. Biol. V. 379 505 2008
PubMed-ID: 18455733  |  Reference-DOI: 10.1016/J.JMB.2008.03.075

(-) Compounds

Molecule 1 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL2, HL4
 
Molecule 2 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL3, HL1
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L4P
    ChainsC
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL4, HL6
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL5, HL13
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL6, HL10
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHS6
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L10E
    ChainsG
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymRIBOSOMAL PROTEIN L10, ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG, L10E, HMAL10
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL11
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL13
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL14, HL27
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL15, HL9
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    Synonym50S RIBOSOMAL PROTEIN LC12
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL18, HL12
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL29, L19
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL19, HL24
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL31
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL22, HL23
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL23, HL25, L21
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL24, HL16, HL15
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL21/HL22
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL29, HL33
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL30, HL20, HL16
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL34, HL30
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL5
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL35E
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL39E, HL46E
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymLA, HLA
 
Molecule 30 - 23S RIBOSOMAL RNA
    Chains0
    MutationYES
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 31 - 5S RIBOSOMAL RNA
    Chains9
    Organism CommonHALOBACTERIUM MARISMORTUI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ01239

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (11, 310)

Asymmetric/Biological Unit (11, 310)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2CD5Ligand/IonCADMIUM ION
3CL22Ligand/IonCHLORIDE ION
4K2Ligand/IonPOTASSIUM ION
5MG93Ligand/IonMAGNESIUM ION
6NA75Ligand/IonSODIUM ION
7OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
8OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
9PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
10SR108Ligand/IonSTRONTIUM ION
11UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (240, 240)

Asymmetric Unit (240, 240)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREA 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:3616 , HOH 0:7781 , HOH 0:9185BINDING SITE FOR RESIDUE MG 08001
002AC2SOFTWAREU 0:626 , G 0:627 , A 0:2483 , C 0:2534 , HOH 0:4343 , HOH 0:7759 , HOH 0:7760BINDING SITE FOR RESIDUE MG 08002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:3665 , HOH A:8933 , HOH A:8959BINDING SITE FOR RESIDUE MG 08003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:3792 , HOH 0:7766 , HOH 0:9054 , HOH 0:9782BINDING SITE FOR RESIDUE MG 08004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:3612 , HOH 0:7782 , HOH 0:7783BINDING SITE FOR RESIDUE MG 08005
006AC6SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:3630 , HOH 0:7775 , HOH 0:7857BINDING SITE FOR RESIDUE MG 08006
007AC7SOFTWAREG 0:2093 , U 0:2610 , G 0:2611 , A 0:2612 , HOH 0:3743 , HOH 0:7445 , HOH 0:7776 , HOH 0:7777BINDING SITE FOR RESIDUE MG 08007
008AC8SOFTWAREG 0:28 , HOH 0:3228 , HOH 0:3648 , HOH 0:7858 , HOH 0:9046 , HOH 0:9646BINDING SITE FOR RESIDUE MG 08008
009AC9SOFTWAREG 0:877 , G 0:2623 , HOH 0:3642 , HOH 0:3655 , HOH 0:7790 , HOH 0:9027BINDING SITE FOR RESIDUE MG 08009
010BC1SOFTWAREG 0:2481 , C 0:2536 , G 0:2537 , HOH 0:3658 , HOH 0:4182 , HOH 0:7757 , HOH 0:9040BINDING SITE FOR RESIDUE MG 08010
011BC2SOFTWAREA 0:844 , A 0:1689 , HOH 0:3622 , HOH 0:7792 , HOH 0:9013 , HOH 0:9030BINDING SITE FOR RESIDUE MG 08011
012BC3SOFTWAREG 0:456 , HOH 0:3961 , HOH 0:7407 , HOH 0:7767 , HOH 0:9429 , GLY C:86 , HOH C:8566BINDING SITE FOR RESIDUE MG 08012
013BC4SOFTWAREA 0:1941 , A 0:2011 , HOH 0:4169 , HOH 0:7247 , HOH 0:7786 , HOH 0:7787 , HOH 0:7788BINDING SITE FOR RESIDUE MG 08013
014BC5SOFTWAREG 0:1828 , C 0:1830 , U 0:1831 , HOH 0:7770 , HOH 0:7789 , HOH 0:9130 , HOH 0:9133 , HOH 0:9206BINDING SITE FOR RESIDUE MG 08014
015BC6SOFTWAREG 0:2304 , HOH 0:3638 , HOH 0:3639 , HOH 0:7773 , HOH 0:7774 , HOH 0:9970BINDING SITE FOR RESIDUE MG 08015
016BC7SOFTWAREA 0:2096 , G 0:2097 , U 0:2539 , G 0:2540 , HOH 0:3883 , HOH 0:7778 , HOH 0:9118 , HOH 0:9472BINDING SITE FOR RESIDUE MG 08016
017BC8SOFTWAREA 0:1381 , HOH 0:5143 , HOH 0:9942BINDING SITE FOR RESIDUE MG 08017
018BC9SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4188 , HOH 0:7796 , HOH 0:7797BINDING SITE FOR RESIDUE MG 08018
019C1SOFTWAREU 0:862 , HOH 0:4902 , HOH 0:9176 , LYS 1:10 , ASN 1:12BINDING SITE FOR RESIDUE SR 18913
020C2SOFTWAREHOH 0:3230 , ASP 1:47BINDING SITE FOR RESIDUE SR 18952
021C3SOFTWARECYS 3:11 , CYS 3:14 , GLN 3:18BINDING SITE FOR RESIDUE CD 38704
022C4SOFTWAREASP 3:66 , LEU 3:88BINDING SITE FOR RESIDUE CL 38804
023C5SOFTWAREGLY 3:45 , GLY 3:47BINDING SITE FOR RESIDUE SR 38932
024C6SOFTWAREG 0:2316 , G 0:2462 , PRO 3:61BINDING SITE FOR RESIDUE SR 38999
025CC1SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:7798 , HOH 0:7799 , HOH 0:7800BINDING SITE FOR RESIDUE MG 08019
026CC2SOFTWAREC 0:240 , U 0:268 , G 0:269 , HOH 0:4031 , HOH 0:7863BINDING SITE FOR RESIDUE MG 08020
027CC3SOFTWAREA 0:1448 , U 0:1677 , HOH 0:3678 , HOH 0:3700 , HOH 0:3711 , HOH S:7764BINDING SITE FOR RESIDUE MG 08021
028CC4SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:7802 , HOH 0:7803 , HOH 0:7804 , HOH 0:7805BINDING SITE FOR RESIDUE MG 08022
029CC5SOFTWAREU 0:1748 , U 0:1749 , HOH 0:3640 , HOH 0:7768 , HOH 0:7769 , HOH 0:7779 , HOH 0:9688BINDING SITE FOR RESIDUE MG 08023
030CC6SOFTWAREU 0:777 , C 0:778 , HOH 0:4902 , HOH 0:7807 , SR 0:8934 , HOH 1:7770BINDING SITE FOR RESIDUE MG 08024
031CC7SOFTWAREU 0:2115 , HOH 0:3727 , HOH 0:4208 , HOH 0:9995 , ALA A:196 , HOH A:9048BINDING SITE FOR RESIDUE MG 08025
032CC8SOFTWAREG 0:956 , HOH 0:3670 , HOH 0:7812 , HOH 0:7813 , HOH 0:7814 , HOH 0:9381BINDING SITE FOR RESIDUE MG 08026
033CC9SOFTWAREA 0:2553 , A 0:2576 , HOH 0:3139 , HOH 0:3212 , HOH 0:3649 , HOH 0:7867 , HOH 0:9084BINDING SITE FOR RESIDUE MG 08027
034DC1SOFTWAREHOH 0:3626 , HOH 0:3650 , HOH 0:3671 , HOH 0:3673 , HOH 0:7816 , HOH 0:9295BINDING SITE FOR RESIDUE MG 08028
035DC2SOFTWAREU 0:115 , A 0:117 , HOH 0:3983 , HOH 0:5120 , HOH 0:9916BINDING SITE FOR RESIDUE MG 08029
036DC3SOFTWAREC 0:171 , U 0:172 , HOH 0:4662 , HOH 0:7870BINDING SITE FOR RESIDUE MG 08030
037DC4SOFTWAREG 0:196 , A 0:227 , C 0:228 , HOH 0:4219 , HOH M:8901BINDING SITE FOR RESIDUE MG 08031
038DC5SOFTWAREU 0:1309 , U 0:1346 , HOH 0:4435 , HOH 0:7819 , HOH 0:9451BINDING SITE FOR RESIDUE MG 08032
039DC6SOFTWAREG 0:816 , G 0:817 , HOH 0:7432 , MG 0:8083 , HOH 0:9820BINDING SITE FOR RESIDUE MG 08033
040DC7SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3297 , GLY R:65 , HOH R:8989BINDING SITE FOR RESIDUE MG 08034
041DC8SOFTWAREG 0:1979 , HOH 0:7820 , HOH 0:7871 , HOH 0:7872 , HOH 0:7873BINDING SITE FOR RESIDUE MG 08035
042DC9SOFTWAREC 0:1793 , G 0:1794 , HOH 0:7309 , HOH 0:7874 , HOH 0:7875BINDING SITE FOR RESIDUE MG 08036
043EC1SOFTWAREA 0:1098 , G 0:1099 , HOH 0:3134 , HOH 0:6282 , HOH 0:7888BINDING SITE FOR RESIDUE MG 08037
044EC2SOFTWAREC 0:2248BINDING SITE FOR RESIDUE MG 08038
045EC3SOFTWAREG 0:641 , A 0:1355 , HOH 0:4120 , HOH 0:7821 , HOH 0:7822BINDING SITE FOR RESIDUE MG 08039
046EC4SOFTWAREU 0:1125 , HOH 0:3868 , G 9:90 , HOH 9:9009BINDING SITE FOR RESIDUE MG 08040
047EC5SOFTWAREC 0:162 , U 0:2276 , HOH 0:7772 , HOH 0:7823 , HOH 0:7824 , HOH 0:9447BINDING SITE FOR RESIDUE MG 08041
048EC6SOFTWAREA 0:2757 , HOH 0:3668 , ASN B:335 , HOH B:9137BINDING SITE FOR RESIDUE MG 08043
049EC7SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5026 , MG 0:8045 , GLN A:207BINDING SITE FOR RESIDUE MG 08044
050EC8SOFTWAREG 0:2013 , HOH 0:3772 , HOH 0:7825 , HOH 0:7826 , HOH 0:7827 , MG 0:8044BINDING SITE FOR RESIDUE MG 08045
051EC9SOFTWAREG 0:2618 , HOH 0:3723 , HOH 0:4069 , HOH 0:7780 , HOH 0:9045 , HOH 0:9049BINDING SITE FOR RESIDUE MG 08046
052FC1SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:7828 , HOH 0:7829 , HOH 0:7830BINDING SITE FOR RESIDUE MG 08047
053FC2SOFTWAREA 0:1369 , U 0:2650 , HOH 0:7831 , HOH 0:7832BINDING SITE FOR RESIDUE MG 08048
054FC3SOFTWAREG 0:1364 , HOH 0:7024 , HOH 0:7452 , HOH 0:7841BINDING SITE FOR RESIDUE MG 08049
055FC4SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:7835 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 08052
056FC5SOFTWAREA 0:2568 , HOH 0:4841 , HOH 0:6228 , HOH 0:7893 , HOH E:920BINDING SITE FOR RESIDUE MG 08053
057FC6SOFTWAREA 0:166 , G 0:219 , HOH 0:3826 , HOH 0:4973 , HOH 0:9131BINDING SITE FOR RESIDUE MG 08055
058FC7SOFTWAREU 0:954 , C 0:2298 , HOH 0:3233 , HOH 0:4013 , HOH 0:7431 , HOH 0:7838 , HOH Q:7872BINDING SITE FOR RESIDUE MG 08056
059FC8SOFTWAREA 0:1286 , A 0:1287 , HOH 0:7836 , HOH W:7804 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 08058
060FC9SOFTWAREA 0:907 , A 0:908 , HOH 0:3637 , HOH 0:3933 , HOH 0:4953 , HOH 0:7837BINDING SITE FOR RESIDUE MG 08059
061GC1SOFTWAREHOH 0:6865 , HOH 0:7843 , HOH 0:7895 , HOH 2:7875BINDING SITE FOR RESIDUE MG 08060
062GC2SOFTWAREG 0:164 , A 0:165 , A 0:167 , C 0:168 , HOH 0:3611 , HOH 0:3617 , HOH 0:3629 , HOH 0:9071BINDING SITE FOR RESIDUE MG 08061
063GC3SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4224 , HOH 0:4510 , HOH 0:7846 , HOH 0:7898BINDING SITE FOR RESIDUE MG 08062
064GC4SOFTWAREHOH 0:5179 , HOH 0:5261 , HOH 0:7907 , HOH P:215BINDING SITE FOR RESIDUE MG 08063
065GC5SOFTWAREA 0:1754 , HOH 0:3707 , HOH 0:4170 , HOH 0:7847 , HOH 0:7899BINDING SITE FOR RESIDUE MG 08064
066GC6SOFTWAREA 0:1742 , G 0:1745 , G 0:2033 , HOH 0:3635 , HOH 0:7848 , HOH 0:9264 , HOH 0:9388 , HOH 0:9758BINDING SITE FOR RESIDUE MG 08065
067GC7SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4377 , HOH 0:4503 , HOH 0:6702 , HOH 0:9045 , HOH 0:9611BINDING SITE FOR RESIDUE MG 08066
068GC8SOFTWAREG 0:2540 , G 0:2611 , HOH 0:3049 , HOH 0:4313 , NA 0:8534 , HOH 0:9070 , HOH 0:9309BINDING SITE FOR RESIDUE MG 08067
069GC9SOFTWAREC 0:515 , A 0:516 , U 0:517 , HOH 0:7851 , HOH 0:7900 , HOH 0:7901BINDING SITE FOR RESIDUE MG 08068
070HC1SOFTWAREA 0:2103 , A 0:2479 , HOH 0:3615 , HOH 0:3806 , HOH 0:5902BINDING SITE FOR RESIDUE MG 08069
071HC2SOFTWAREG 0:918 , C 0:2294 , HOH 0:3323 , HOH 0:4175 , HOH 0:6497 , HOH 0:9560BINDING SITE FOR RESIDUE MG 08070
072HC3SOFTWAREA 0:1843 , C 0:1844 , HOH 0:3645 , HOH 0:3659 , HOH 0:7902 , HOH 0:9400BINDING SITE FOR RESIDUE MG 08071
073HC4SOFTWAREA 0:1070 , G 0:1071 , HOH 0:3651 , HOH 0:3682 , HOH 0:3724BINDING SITE FOR RESIDUE MG 08072
074HC5SOFTWAREU 0:1096 , C 0:1257 , G 0:1258 , HOH 0:7853BINDING SITE FOR RESIDUE MG 08073
075HC6SOFTWAREG 0:1848 , G 0:1849 , HOH 0:3662 , HOH 0:3701 , HOH 0:3844 , HOH 0:3878BINDING SITE FOR RESIDUE MG 08075
076HC7SOFTWAREG 0:782 , G 0:863 , U 0:864 , HOH 0:3339 , HOH 0:3672 , HOH 0:3676 , HOH 0:5568BINDING SITE FOR RESIDUE MG 08076
077HC8SOFTWAREA 0:907 , HOH 0:3369 , HOH 0:3684 , HOH 0:3752 , HOH 0:9948 , LYS Y:145 , HOH Y:8873BINDING SITE FOR RESIDUE MG 08077
078HC9SOFTWAREA 0:2612 , HOH 0:3018 , HOH 0:3666 , HOH 0:3679BINDING SITE FOR RESIDUE MG 08078
079IC1SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4640 , HOH 0:6920BINDING SITE FOR RESIDUE MG 08079
080IC2SOFTWAREA 0:2434 , U 0:2435 , HOH 0:9267 , ASP 3:66BINDING SITE FOR RESIDUE MG 08080
081IC3SOFTWAREG 0:2578 , G 0:2579 , HOH 0:7904BINDING SITE FOR RESIDUE MG 08081
082IC4SOFTWAREC 0:2104 , C 0:2105BINDING SITE FOR RESIDUE MG 08082
083IC5SOFTWAREG 0:817 , HOH 0:3600 , HOH 0:7432 , MG 0:8033 , SER P:90 , HOH P:187BINDING SITE FOR RESIDUE MG 08083
084IC6SOFTWAREC 0:1103 , A 0:1106 , A 0:1107 , HOH 0:7878 , HOH 0:7879 , HOH 0:7880 , HOH 0:7881BINDING SITE FOR RESIDUE MG 08084
085IC7SOFTWAREU 0:1977 , G 0:1986 , HOH 0:7883 , HOH 0:7884 , HOH 0:7885BINDING SITE FOR RESIDUE MG 08085
086IC8SOFTWAREU 0:903 , A 0:1357 , HOH 0:3943 , HOH 0:5420 , HOH 0:6041 , HOH 0:9524BINDING SITE FOR RESIDUE MG 08087
087IC9SOFTWAREA 0:187 , HOH 0:3729 , HOH 0:3776 , HOH 0:9137 , HOH 0:9344 , HOH 0:9580BINDING SITE FOR RESIDUE MG 08088
088JC1SOFTWAREA 0:2112 , HOH 0:3758 , HOH 0:3941 , HOH 0:6139 , HOH 0:6412 , HOH 0:9600BINDING SITE FOR RESIDUE MG 08089
089JC2SOFTWAREC 0:2431 , HOH 0:4078 , HOH 0:9363 , HOH 0:9465 , LYS 3:54 , HOH 3:9029 , HOH 3:9034BINDING SITE FOR RESIDUE MG 08090
090JC3SOFTWAREHOH 0:4305 , HOH 0:4322 , HOH 0:6612 , MG 0:8092BINDING SITE FOR RESIDUE MG 08091
091JC4SOFTWAREU 0:1850 , HOH 0:3689 , HOH 0:3878 , MG 0:8091BINDING SITE FOR RESIDUE MG 08092
092JC5SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:6572 , HOH 0:9238BINDING SITE FOR RESIDUE MG 08093
093JC6SOFTWAREG 0:2102 , A 0:2482 , U 0:2535 , C 0:2536 , U 0:2539BINDING SITE FOR RESIDUE K 08401
094JC7SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3172 , HOH 0:3202 , HOH 0:4986BINDING SITE FOR RESIDUE NA 08501
095JC8SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:4188BINDING SITE FOR RESIDUE NA 08502
096JC9SOFTWAREA 0:630 , A 0:631 , G 0:2070 , A 0:2074 , HOH 0:4105 , HOH 0:4722 , HOH 0:5794BINDING SITE FOR RESIDUE NA 08504
097KC1SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649BINDING SITE FOR RESIDUE NA 08505
098KC2SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 08506
099KC3SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:3409 , SR 0:8962BINDING SITE FOR RESIDUE NA 08507
100KC4SOFTWAREA 0:2577 , G 0:2578 , G 0:2579BINDING SITE FOR RESIDUE NA 08508
101KC5SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:3577BINDING SITE FOR RESIDUE NA 08509
102KC6SOFTWAREG 0:2399 , HOH 0:3845 , HOH 0:5088 , HOH 0:5140 , HOH 0:9958BINDING SITE FOR RESIDUE NA 08511
103KC7SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3135 , HOH 0:9345 , HOH 0:9502 , TRP B:242BINDING SITE FOR RESIDUE NA 08512
104KC8SOFTWAREA 0:165 , A 0:166 , A 0:167BINDING SITE FOR RESIDUE NA 08513
105KC9SOFTWAREC 0:896 , A 0:897 , HOH 0:6327 , HOH 0:9036BINDING SITE FOR RESIDUE NA 08514
106LC1SOFTWAREG 0:1416 , G 0:1417 , HOH 0:9291 , TRP 2:42 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 08515
107LC2SOFTWAREG 0:2543 , G 0:2544 , HOH 0:3461 , HOH 0:3947 , NA 0:8517BINDING SITE FOR RESIDUE NA 08516
108LC3SOFTWAREG 0:2543 , G 0:2544 , G 0:2611 , U 0:2615 , NA 0:8516 , HOH 0:9094 , HOH 0:9751BINDING SITE FOR RESIDUE NA 08517
109LC4SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , HOH 0:4498BINDING SITE FOR RESIDUE NA 08519
110LC5SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:7170 , HOH 0:9510BINDING SITE FOR RESIDUE NA 08520
111LC6SOFTWAREA 0:776 , U 0:777 , U 0:779 , A 0:780 , HOH 0:3277 , HOH 0:7670 , HOH 0:9634BINDING SITE FOR RESIDUE NA 08521
112LC7SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 08522
113LC8SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3206BINDING SITE FOR RESIDUE NA 08523
114LC9SOFTWAREG 0:56 , A 0:59 , G 0:61 , HOH 0:6492BINDING SITE FOR RESIDUE NA 08524
115MC1SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:6589BINDING SITE FOR RESIDUE NA 08525
116MC2SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9249BINDING SITE FOR RESIDUE NA 08526
117MC3SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221BINDING SITE FOR RESIDUE NA 08527
118MC4SOFTWAREG 0:386 , G 0:387 , G 0:388 , U 0:402 , HOH 0:7090BINDING SITE FOR RESIDUE NA 08528
119MC5SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5267BINDING SITE FOR RESIDUE NA 08529
120MC6SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:9880BINDING SITE FOR RESIDUE NA 08530
121MC7SOFTWAREG 0:1706 , G 0:1707 , HOH 0:5358 , HOH 0:7363 , HOH 0:7700 , HOH 0:9930BINDING SITE FOR RESIDUE NA 08531
122MC8SOFTWAREU 0:2659 , G 0:2660 , HOH 0:3767 , VAL R:72 , TRP R:75 , HOH R:8918BINDING SITE FOR RESIDUE NA 08533
123MC9SOFTWAREG 0:2540 , G 0:2616 , U 0:2645 , HOH 0:3031 , MG 0:8067BINDING SITE FOR RESIDUE NA 08534
124NC1SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:6287 , HOH 0:6835BINDING SITE FOR RESIDUE NA 08535
125NC2SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:7908BINDING SITE FOR RESIDUE NA 08536
126NC3SOFTWAREU 0:308 , G 0:334 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 08537
127NC4SOFTWAREA 0:914 , C 0:915 , C 0:1043 , G 0:1045 , HOH 0:5602BINDING SITE FOR RESIDUE NA 08541
128NC5SOFTWAREU 0:623 , C 0:633 , G 0:901 , HOH 0:6975BINDING SITE FOR RESIDUE NA 08542
129NC6SOFTWAREA 0:955 , HOH 0:6328 , U 9:82BINDING SITE FOR RESIDUE NA 08544
130NC7SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:4838BINDING SITE FOR RESIDUE NA 08545
131NC8SOFTWAREG 0:1119 , C 0:1243 , HOH J:8839BINDING SITE FOR RESIDUE NA 08546
132NC9SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , A 0:2467 , HOH 0:9469BINDING SITE FOR RESIDUE NA 08547
133OC1SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:4016 , HOH 0:6286BINDING SITE FOR RESIDUE NA 08548
134OC2SOFTWAREU 0:2610 , G 0:2611 , HOH 0:9502BINDING SITE FOR RESIDUE NA 08549
135OC3SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 08550
136OC4SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5965BINDING SITE FOR RESIDUE NA 08551
137OC5SOFTWAREG 0:2110 , G 0:2111 , U 0:2277 , HOH 0:5329BINDING SITE FOR RESIDUE NA 08553
138OC6SOFTWAREU 0:1359 , C 0:1360BINDING SITE FOR RESIDUE NA 08554
139OC7SOFTWAREU 0:2057 , G 0:2058 , HOH 0:9603 , HOH 0:9823BINDING SITE FOR RESIDUE NA 08555
140OC8SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 08556
141OC9SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3831 , HOH 0:3894BINDING SITE FOR RESIDUE NA 08557
142PC1SOFTWAREG 0:464 , G 0:475 , HOH 0:4497 , HOH 0:9835 , ARG C:55BINDING SITE FOR RESIDUE NA 08558
143PC2SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 08559
144PC3SOFTWAREU 0:392 , A 0:395 , SR 0:8953 , ARG 3:42BINDING SITE FOR RESIDUE NA 08560
145PC4SOFTWAREG 0:1832 , A 0:2022 , HOH 0:3784 , HOH 0:4119 , HOH 0:9112BINDING SITE FOR RESIDUE NA 08561
146PC5SOFTWAREU 0:2492 , G 0:2529BINDING SITE FOR RESIDUE NA 08562
147PC6SOFTWAREU 0:919 , G 0:921 , G 0:924BINDING SITE FOR RESIDUE NA 08563
148PC7SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , HOH 0:7313BINDING SITE FOR RESIDUE NA 08564
149PC8SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 08565
150PC9SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9277BINDING SITE FOR RESIDUE NA 08566
151QC1SOFTWAREG 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:6354BINDING SITE FOR RESIDUE NA 08567
152QC2SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3210 , HIS L:18 , ARG L:21 , HOH L:8992 , HOH L:9013BINDING SITE FOR RESIDUE NA 08568
153QC3SOFTWAREU 0:831 , U 0:832 , G 0:833 , C 0:849 , U 0:850 , HOH 0:3714BINDING SITE FOR RESIDUE NA 08569
154QC4SOFTWAREU 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:3691 , HOH 0:6119 , HOH 0:7092 , HOH 0:9303BINDING SITE FOR RESIDUE NA 08570
155QC5SOFTWAREG 0:2772 , G 0:2773 , HOH 0:4389BINDING SITE FOR RESIDUE NA 08571
156QC6SOFTWAREC 0:197BINDING SITE FOR RESIDUE NA 08573
157QC7SOFTWAREG 0:1077 , A 0:1079 , C 0:1080 , HOH 0:7692BINDING SITE FOR RESIDUE NA 08574
158QC8SOFTWAREU 0:12 , C 0:2086 , C 0:2087 , ASN R:63BINDING SITE FOR RESIDUE NA 08575
159QC9SOFTWAREG 0:1452 , G 0:1676BINDING SITE FOR RESIDUE CL 08803
160RC1SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 08805
161RC2SOFTWAREC 0:2388 , HOH 0:3166 , PHE Q:52 , HIS Q:53BINDING SITE FOR RESIDUE CL 08811
162RC3SOFTWAREG 0:2582 , A 0:2596 , HOH 0:5117 , LYS K:14 , ILE K:32 , SER K:33BINDING SITE FOR RESIDUE CL 08812
163RC4SOFTWAREG 0:1300 , A 0:1328 , G 0:1329 , HOH 0:4678 , HOH 0:4966BINDING SITE FOR RESIDUE CL 08813
164RC5SOFTWAREG 0:644 , HIS L:13 , HOH L:9054BINDING SITE FOR RESIDUE CL 08814
165RC6SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 08815
166RC7SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 08816
167RC8SOFTWAREC 0:594 , U 0:595 , ARG Y:115BINDING SITE FOR RESIDUE CL 08817
168RC9SOFTWAREG 0:1072 , G 0:1087BINDING SITE FOR RESIDUE CL 08822
169SC1SOFTWAREG 0:824 , G 0:854 , HOH 0:3976 , HOH 0:4310 , HOH 0:4438 , HOH 0:4548BINDING SITE FOR RESIDUE SR 08901
170SC2SOFTWAREG 0:836 , U 0:2615 , HOH 0:3850 , HOH 0:9285 , HOH 0:9375 , GLN B:230 , HOH B:9114BINDING SITE FOR RESIDUE SR 08902
171SC3SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3633 , HOH 0:3975 , HOH 0:6180 , HOH 0:9410BINDING SITE FOR RESIDUE SR 08903
172SC4SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:6593 , HOH 0:7584 , HOH 0:9445BINDING SITE FOR RESIDUE SR 08904
173SC5SOFTWAREA 0:1755 , HOH 0:7183 , HOH 0:7603BINDING SITE FOR RESIDUE SR 08905
174SC6SOFTWAREC 0:893 , HOH 0:6279 , HOH C:8548BINDING SITE FOR RESIDUE SR 08906
175SC7SOFTWAREG 0:1055 , HOH 0:3837 , HOH 0:4070 , HOH 0:4847 , HOH 0:6344 , HOH 0:9585 , ASP H:13BINDING SITE FOR RESIDUE SR 08907
176SC8SOFTWAREU 0:146 , G 0:147 , A 0:183 , HOH 0:3708 , ASP M:157BINDING SITE FOR RESIDUE SR 08908
177SC9SOFTWAREHOH 0:3775 , HOH 0:5523 , HOH 0:6162 , HOH 0:6606 , HOH 0:7854BINDING SITE FOR RESIDUE SR 08909
178TC1SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3825BINDING SITE FOR RESIDUE SR 08910
179TC2SOFTWAREC 0:85 , A 0:86 , C 0:87 , HOH 0:5374 , ASP T:68BINDING SITE FOR RESIDUE SR 08911
180TC3SOFTWAREHOH 0:4897 , HOH 0:5239BINDING SITE FOR RESIDUE SR 08914
181TC4SOFTWAREU 0:664 , G 0:681 , HOH C:8542BINDING SITE FOR RESIDUE SR 08915
182TC5SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4115BINDING SITE FOR RESIDUE SR 08916
183TC6SOFTWAREU 0:454 , C 0:478 , HOH 0:3958 , HOH 0:4239 , HOH 0:6155BINDING SITE FOR RESIDUE SR 08917
184TC7SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:3750 , HOH 0:7784BINDING SITE FOR RESIDUE SR 08918
185TC8SOFTWAREG 0:2543 , HOH 0:6385BINDING SITE FOR RESIDUE SR 08919
186TC9SOFTWAREG 0:2632BINDING SITE FOR RESIDUE SR 08920
187UC1SOFTWAREA 0:1717 , G 0:1718 , HOH 0:5362BINDING SITE FOR RESIDUE SR 08921
188UC2SOFTWAREG 0:471 , HOH 0:3044 , HOH 0:9215 , HOH 0:9256BINDING SITE FOR RESIDUE SR 08922
189UC3SOFTWAREG 0:1059 , C 0:1127 , HOH 0:3728 , HOH 0:3833 , HOH 0:9124BINDING SITE FOR RESIDUE SR 08923
190UC4SOFTWAREG 0:2725 , G 0:2755 , HOH 0:5094 , HOH 0:6352BINDING SITE FOR RESIDUE SR 08924
191UC5SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 08925
192UC6SOFTWAREHOH 0:3340 , HOH 0:6461BINDING SITE FOR RESIDUE SR 08926
193UC7SOFTWAREA 0:2553 , HOH 0:7868BINDING SITE FOR RESIDUE SR 08927
194UC8SOFTWAREU 0:1109 , G 0:1110 , A 0:1247BINDING SITE FOR RESIDUE SR 08928
195UC9SOFTWAREG 0:1543 , HOH 0:6105BINDING SITE FOR RESIDUE SR 08931
196VC1SOFTWAREA 0:532 , U 0:533 , HOH 0:3736 , HOH 0:7850BINDING SITE FOR RESIDUE SR 08933
197VC2SOFTWAREU 0:777 , C 0:778 , HOH 0:3277 , HOH 0:7807 , MG 0:8024BINDING SITE FOR RESIDUE SR 08934
198VC3SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:7876BINDING SITE FOR RESIDUE SR 08935
199VC4SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3222 , HOH 0:7859BINDING SITE FOR RESIDUE SR 08936
200VC5SOFTWAREHOH 0:4314 , HOH 0:6050 , HOH 0:7552BINDING SITE FOR RESIDUE SR 08937
201VC6SOFTWAREHOH 0:5035BINDING SITE FOR RESIDUE SR 08938
202VC7SOFTWAREC 0:85 , ASP T:68BINDING SITE FOR RESIDUE SR 08939
203VC8SOFTWAREA 0:2465 , G 0:2466 , HOH 0:6055 , ASP L:36BINDING SITE FOR RESIDUE SR 08940
204VC9SOFTWAREG 0:1683 , U 0:1696 , HOH 0:4858BINDING SITE FOR RESIDUE SR 08941
205WC1SOFTWAREC 0:2745 , A 0:2746 , U 0:2749 , G 0:2750 , HOH 0:7911BINDING SITE FOR RESIDUE SR 08942
206WC2SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6130 , HOH 0:6590BINDING SITE FOR RESIDUE SR 08943
207WC3SOFTWAREU 0:2016BINDING SITE FOR RESIDUE SR 08944
208WC4SOFTWAREC 0:1456 , G 0:1484 , HOH 0:3716 , HOH 0:7811 , HOH 0:7865BINDING SITE FOR RESIDUE SR 08945
209WC5SOFTWAREG 0:2091 , HOH 0:6115BINDING SITE FOR RESIDUE SR 08946
210WC6SOFTWAREC 0:1690 , HOH 2:6577BINDING SITE FOR RESIDUE SR 08947
211WC7SOFTWAREA 0:2302 , A 0:2303 , HOH 0:3643BINDING SITE FOR RESIDUE SR 08948
212WC8SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , G 0:856 , HOH 0:3618 , HOH 0:3759 , HOH 0:9815BINDING SITE FOR RESIDUE SR 08949
213WC9SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 08951
214XC1SOFTWAREU 0:392 , NA 0:8560 , ARG 3:42BINDING SITE FOR RESIDUE SR 08953
215XC2SOFTWAREG 0:2810 , HOH 0:4063 , HOH 0:7612 , ASN B:27BINDING SITE FOR RESIDUE SR 08954
216XC3SOFTWAREU 0:2557 , HOH 0:3063 , HOH 0:6673BINDING SITE FOR RESIDUE SR 08955
217XC4SOFTWAREA 0:682 , G 0:683BINDING SITE FOR RESIDUE SR 08956
218XC5SOFTWAREU 0:1463 , C 0:1474BINDING SITE FOR RESIDUE SR 08957
219XC6SOFTWAREA 0:1133 , G 0:1134 , HOH 0:9441BINDING SITE FOR RESIDUE SR 08958
220XC7SOFTWAREU 0:1972 , HOH 0:9681BINDING SITE FOR RESIDUE SR 08959
221XC8SOFTWAREG 0:1113 , HOH 0:3695BINDING SITE FOR RESIDUE SR 08960
222XC9SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , NA 0:8507 , HOH 0:9310BINDING SITE FOR RESIDUE SR 08962
223YC1SOFTWAREG 0:2284 , G 0:2285BINDING SITE FOR RESIDUE SR 08963
224YC2SOFTWAREG 0:2777 , HOH 0:7376BINDING SITE FOR RESIDUE SR 08964
225YC3SOFTWAREHOH 0:4129 , HOH 0:7437 , HOH 0:7570 , HOH 0:7839BINDING SITE FOR RESIDUE SR 08965
226YC4SOFTWAREC 0:235 , HOH 0:4723 , HOH 0:5467 , HOH 0:6163 , HOH 0:7574BINDING SITE FOR RESIDUE SR 08966
227YC5SOFTWAREU 0:2690 , HOH 0:3058 , HOH 0:5552BINDING SITE FOR RESIDUE SR 08967
228YC6SOFTWAREG 0:2522 , C 9:91 , HOH 9:9074BINDING SITE FOR RESIDUE SR 08968
229YC7SOFTWAREA 0:565 , G 0:592BINDING SITE FOR RESIDUE SR 08970
230YC8SOFTWAREHOH 0:6464 , HOH 0:7314 , HOH 0:7473BINDING SITE FOR RESIDUE SR 08973
231YC9SOFTWAREU 0:1835BINDING SITE FOR RESIDUE SR 08974
232ZC1SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE SR 08975
233ZC2SOFTWAREG 0:2249 , GLU A:28BINDING SITE FOR RESIDUE SR 08977
234ZC3SOFTWAREG 0:2639 , HOH 0:6642BINDING SITE FOR RESIDUE SR 08979
235ZC4SOFTWAREG 0:1290 , A 0:1291 , HOH 0:4979 , HOH 0:7859BINDING SITE FOR RESIDUE SR 08981
236ZC5SOFTWAREA 0:1746 , A 0:1747 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 08982
237ZC6SOFTWAREG 0:911 , G 0:1292 , HOH 0:3394 , HOH 0:4284BINDING SITE FOR RESIDUE SR 08983
238ZC7SOFTWAREA 0:378 , G 0:379 , A 0:429 , HOH 0:3801 , HOH 0:4584BINDING SITE FOR RESIDUE SR 08984
239ZC8SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 08985
240ZC9SOFTWAREC 0:1102 , C 0:1103BINDING SITE FOR RESIDUE SR 08986

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CCS)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 3CCS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                3ccs 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGAAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d3ccs11 1:1-56 50S subunit                               SCOP domains
               CATH domains 3ccs100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee...................hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                3ccs 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d3ccs21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 3ccs200 2:1-49                                    CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh....hhhhhhhhh.---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                3ccs 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d3ccs31 3:1-92 50S subunit                                                                   SCOP domains
               CATH domains 3ccs300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee....eeeeeeeee.........hhhhhhhhhhh......................eeeee..................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                3ccs 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                3ccs 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3ccsA01 A:1-78 Nucleic acid-binding proteins                                  ---3ccsA02 A:82-159  [code=2.30.30.30, no name defined]                          3ccsA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh..............eeeeeeeee........eeeeee....eeeee.........eeee..........eee.hhh....eee...................eeeeee....eeee.....eeee....eeee..............hhhhhhhhhhhh.......hhhhh...................ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d3ccsb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 3ccsB01 B:1-38,B:207-257              3ccsB02 B:39-77,B:189-206,B:258-337    3ccsB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         3ccsB02           3ccsB01 B:1-38,B:207-257                           3ccsB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhh......................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeee.......hhhhh.......hhhhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee..eeeeehhhhhhh....hhhhhhh........................eeee..eeeeeeeeeeeeeee................eeeeeee.........eeee...............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3ccsC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhh..............................ee..ee.........................hhhhhhhhhhhhhhh..hhhhhhhhh.........eeehhhhh...hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ccs C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d3ccsd1 D:10-174 50S      subunit                                                                                                                                     SCOP domains
               CATH domains 3ccsD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..eeeeeeee.....-----..hhhhhhhhh....eee.................eeeeee.hhhhhhhhhhhh..............eeee.--------------------.eeeeeee...hhhhhh.............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3ccsE01 E:1-79  [code=3.90.930.12, no name defined]                            3ccsE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d3ccsf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 3ccsF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhh....eeee.....hhhhhhhhhhhhh....eeee.hhhhhhhhh.......eee......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------.hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3ccs G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d3ccsh1 H:4-166 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 3ccsH00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh................................hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh....eeeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhh......eeeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d3ccsi1 I:66-129 Ribosomal protein L11, C-terminal domain       ------ SCOP domains
               CATH domains 3ccsI00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh.............eee.hhhhhhhhhhh.......hhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                3ccs I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d3ccsj1 J:4-145 50S subunit                                                                                                                    SCOP domains
               CATH domains 3ccsJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhh....eeee.....eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d3ccsk1 K:1-132 50S subunit                                                                                                          SCOP domains
               CATH domains 3ccsK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee..............eehhhhhhhhhhhh....ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ccs K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d3ccsl1 L:1-150 50S subunit                                                                                                                            SCOP domains
               CATH domains 3ccsL01 L:1-50                                    3ccsL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh..............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhh...eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ccs L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3ccsM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh....hhhhhhhhhhhhhhhh....eee.....hhhhhhhhh......eeeeeeeee...........................hhhhhhhhhhhhhh...eeeeeeeeeee..eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs M    1 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d3ccsn1 N:1-186 50S subunit                                                                                                                                                                SCOP domains
               CATH domains 3ccsN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeee...hhhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ccs N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d3ccso1 O:1-115 50S subunit                                                                                         SCOP domains
               CATH domains 3ccsO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d3ccsp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 3ccsP01 P:1-55  [code=1.10.1650.10, no name defined]   3ccsP02 P:56-88 Single Heli x bin3ccsP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhh..hhhhhhhhhhh..eee.......hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d3ccsq1 Q:1-95 50S subunit                                                                      SCOP domains
               CATH domains 3ccsQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhh................eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                3ccs Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d3ccsr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 3ccsR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ccs R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d3ccss1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 3ccsS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhh..eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                3ccs S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d3ccst1 T:1-119 50S subunit                                                                                             SCOP domains
               CATH domains 3ccsT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d3ccsu1 U:4-56 50S subunit                            SCOP domains
               CATH domains 3ccsU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                3ccs U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d3ccsv1 V:1-65 50S subunit                                        SCOP domains
               CATH domains 3ccsV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                3ccs V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d3ccsw1 W:1-154 50S subunit                                                                                                                                SCOP domains
               CATH domains 3ccsW01 W:1-57,W:114-154                                 3ccsW02 W:58-113  [code=1.10.15.30, no name defined]    3ccsW01 W:1-57,W:114-154                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eee...hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.....................ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d3ccsx1 X:7-88 50S subunit                                                         SCOP domains
               CATH domains 3ccsX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhheehhhhhhhhh.........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3ccs X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d3ccsy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ccs Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains -d3ccsz1 Z:35-106 Ribosomal protein L37ae                                 SCOP domains
               CATH domains 3ccsZ00 Z:34-106  [code=2.20.25.30, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh....hhhhh...hhhhhh..............ee....eee.......ee...........hhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                3ccs Z   34 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS  106
                                    43        53        63        73        83        93       103   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (11, 24)

Asymmetric/Biological Unit
10ad3ccs111:1-56
10bd3ccs313:1-92
10cd3ccsd1D:10-174
10dd3ccsj1J:4-145
10ed3ccsk1K:1-132
10fd3ccsl1L:1-150
10gd3ccsn1N:1-186
10hd3ccso1O:1-115
10id3ccsq1Q:1-95
10jd3ccst1T:1-119
10kd3ccsu1U:4-56
10ld3ccsv1V:1-65
10md3ccsw1W:1-154
10nd3ccsx1X:7-88

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CCS)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    C1  [ RasMol ]  +environment [ RasMol ]
    C2  [ RasMol ]  +environment [ RasMol ]
    C3  [ RasMol ]  +environment [ RasMol ]
    C4  [ RasMol ]  +environment [ RasMol ]
    C5  [ RasMol ]  +environment [ RasMol ]
    C6  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ccs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P606171ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P158251jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P141221c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P291981ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P224501c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P606181ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P127371ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P127331ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P141231ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P141191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P127341ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P109701ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P127321ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P141161ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P109721ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P109711ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P202761c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P141211ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P181381ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P127361ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P606191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P324101ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P224521ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P202791ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P324111ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P127351ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P141241ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P141351c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P127431ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

3cc2 STARTING MODEL FOR MOLECULAR REPLACEMENT
3cc4
3cc7
3cce
3ccj
3ccl
3ccm
3ccq
3ccr
3ccu
3ccv
3cd6