1YHQ | RR0112 - JenaLib

Asymmetric Unit (305, 305)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	C 0:839 , A 0:2099 , A 0:2100 , A 0:2103 , A 0:2538 , G 0:2540 , U 0:2645 , G 0:2646	BINDING SITE FOR RESIDUE ZIT 0 9500
002	AC2	SOFTWARE	G 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:4111 , HOH 0:8293 , HOH 0:9675	BINDING SITE FOR RESIDUE MG 0 8001
003	AC3	SOFTWARE	G 0:627 , A 0:2483 , C 0:2534 , HOH 0:4813 , HOH 0:8271 , HOH 0:8272	BINDING SITE FOR RESIDUE MG 0 8002
004	AC4	SOFTWARE	A 0:876 , G 0:877 , A 0:2624 , HOH 0:4163 , HOH A:8980 , HOH A:8999	BINDING SITE FOR RESIDUE MG 0 8003
005	AC5	SOFTWARE	G 0:456 , A 0:459 , HOH 0:3279 , HOH 0:4278 , HOH 0:8278 , HOH 0:9545	BINDING SITE FOR RESIDUE MG 0 8004
006	AC6	SOFTWARE	A 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4108 , HOH 0:8294 , HOH 0:8295	BINDING SITE FOR RESIDUE MG 0 8005
007	AC7	SOFTWARE	U 0:919 , C 0:2464 , A 0:2465 , HOH 0:4125 , HOH 0:8287 , HOH 0:8367	BINDING SITE FOR RESIDUE MG 0 8006
008	AC8	SOFTWARE	U 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4234 , HOH 0:7878 , HOH 0:8288 , HOH 0:8289	BINDING SITE FOR RESIDUE MG 0 8007
009	AC9	SOFTWARE	G 0:28 , HOH 0:3139 , HOH 0:3729 , HOH 0:4144 , HOH 0:8368 , HOH 0:9537	BINDING SITE FOR RESIDUE MG 0 8008
010	AD1	SOFTWARE	A 0:1291 , G 0:1292 , HOH 0:3560 , HOH 0:4754	BINDING SITE FOR RESIDUE SR 0 8983
011	AD2	SOFTWARE	A 0:378 , G 0:379 , A 0:429 , HOH 0:5055 , HOH 0:7932	BINDING SITE FOR RESIDUE SR 0 8984
012	AD3	SOFTWARE	U 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:8430	BINDING SITE FOR RESIDUE SR 0 8985
013	AD4	SOFTWARE	C 0:1102 , C 0:1103 , HOH 0:3046 , GLU J:28	BINDING SITE FOR RESIDUE SR 0 8986
014	AD5	SOFTWARE	G 0:2700 , HOH 0:4065	BINDING SITE FOR RESIDUE SR 0 8988
015	AD6	SOFTWARE	A 0:2622 , G 0:2623 , HOH 0:6353	BINDING SITE FOR RESIDUE SR 0 8989
016	AD7	SOFTWARE	G 0:2617 , G 0:2618 , HOH 0:4123 , HOH 0:4314	BINDING SITE FOR RESIDUE SR 0 8990
017	AD8	SOFTWARE	A 0:1427 , HOH 0:8266	BINDING SITE FOR RESIDUE SR 0 8991
018	AD9	SOFTWARE	U 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3092 , HOH 0:4248 , HOH 0:4256	BINDING SITE FOR RESIDUE SR 0 8992
019	BC1	SOFTWARE	G 0:877 , G 0:2623 , HOH 0:4138 , HOH 0:4151 , HOH 0:9519 , HOH A:9089	BINDING SITE FOR RESIDUE MG 0 8009
020	BC2	SOFTWARE	A 0:2101 , G 0:2102 , G 0:2537 , HOH 0:4156 , HOH 0:4656 , HOH 0:8269 , HOH 0:9531	BINDING SITE FOR RESIDUE MG 0 8010
021	BC3	SOFTWARE	A 0:844 , A 0:1689 , HOH 0:4117 , HOH 0:8303 , HOH 0:9504 , HOH 0:9522	BINDING SITE FOR RESIDUE MG 0 8011
022	BC4	SOFTWARE	G 0:456 , HOH 0:4435 , HOH 0:7845 , HOH 0:8279 , HOH 0:9915 , HOH C:8562	BINDING SITE FOR RESIDUE MG 0 8012
023	BC5	SOFTWARE	A 0:2011 , HOH 0:4643 , HOH 0:7691 , HOH 0:8298 , HOH 0:8299 , HOH 0:8300	BINDING SITE FOR RESIDUE MG 0 8013
024	BC6	SOFTWARE	C 0:1830 , HOH 0:8282 , HOH 0:8301 , HOH 0:9619 , HOH 0:9622 , HOH 0:9696	BINDING SITE FOR RESIDUE MG 0 8014
025	BC7	SOFTWARE	G 0:2304 , HOH 0:3467 , HOH 0:4134 , HOH 0:4135 , HOH 0:8285 , HOH 0:8286	BINDING SITE FOR RESIDUE MG 0 8015
026	BC8	SOFTWARE	G 0:2097 , U 0:2539 , G 0:2540 , HOH 0:4364 , HOH 0:8290 , HOH 0:9607 , HOH 0:9957	BINDING SITE FOR RESIDUE MG 0 8016
027	BC9	SOFTWARE	A 0:1381 , HOH 0:3438 , HOH 0:5602	BINDING SITE FOR RESIDUE MG 0 8017
028	BD1	SOFTWARE	GLY A:236	BINDING SITE FOR RESIDUE SR 0 8993
029	BD2	SOFTWARE	A 0:846 , G 0:1694	BINDING SITE FOR RESIDUE SR 0 8994
030	BD3	SOFTWARE	G 0:2609 , U 0:2610 , HOH 0:3800 , HOH 0:4194 , HOH 0:4217 , HOH 0:6083 , HOH 0:6228	BINDING SITE FOR RESIDUE SR 0 8995
031	BD4	SOFTWARE	U 0:1412 , A 0:1682 , HOH 0:7546	BINDING SITE FOR RESIDUE SR 0 8996
032	BD5	SOFTWARE	A 0:790 , A 0:791 , HOH 0:6203	BINDING SITE FOR RESIDUE SR 0 8997
033	BD6	SOFTWARE	G 0:834 , U 0:835 , HOH 0:4401	BINDING SITE FOR RESIDUE SR 0 8998
034	BD7	SOFTWARE	U 0:2461 , HOH 0:6713 , ASP 3:59	BINDING SITE FOR RESIDUE SR 0 8999
035	BD8	SOFTWARE	C 0:1536	BINDING SITE FOR RESIDUE SR 0 9000
036	BD9	SOFTWARE	C 0:2591 , HOH 0:6077 , HOH 0:6400	BINDING SITE FOR RESIDUE SR 0 9001
037	CC1	SOFTWARE	U 0:1120 , G 0:1121 , HOH 0:4661 , HOH 0:8306 , HOH 0:8307 , HOH 0:8372	BINDING SITE FOR RESIDUE MG 0 8018
038	CC2	SOFTWARE	C 0:2608 , G 0:2609 , U 0:2610 , HOH 0:8308 , HOH 0:8309 , HOH 0:8310 , HOH 0:9894	BINDING SITE FOR RESIDUE MG 0 8019
039	CC3	SOFTWARE	C 0:240 , G 0:269 , HOH 0:4367 , HOH 0:4508 , HOH 0:4648 , HOH 0:8373	BINDING SITE FOR RESIDUE MG 0 8020
040	CC4	SOFTWARE	A 0:1448 , U 0:1677 , HOH 0:4175 , HOH 0:4196 , HOH 0:4207 , HOH S:8993	BINDING SITE FOR RESIDUE MG 0 8021
041	CC5	SOFTWARE	U 0:1503 , A 0:1504 , C 0:1679 , HOH 0:8312 , HOH 0:8313 , HOH 0:8314	BINDING SITE FOR RESIDUE MG 0 8022
042	CC6	SOFTWARE	U 0:1748 , U 0:1749 , HOH 0:4136 , HOH 0:8280 , HOH 0:8281 , HOH 0:8291	BINDING SITE FOR RESIDUE MG 0 8023
043	CC7	SOFTWARE	U 0:777 , C 0:778 , HOH 0:3777 , HOH 0:8317 , SR 0:8934 , HOH 1:9002	BINDING SITE FOR RESIDUE MG 0 8024
044	CC8	SOFTWARE	U 0:2115 , HOH 0:3492 , HOH 0:4284 , HOH 0:4682 , ALA A:196 , HOH A:9015 , HOH A:9090	BINDING SITE FOR RESIDUE MG 0 8025
045	CC9	SOFTWARE	G 0:956 , HOH 0:4167 , HOH 0:8321 , HOH 0:8322 , HOH 0:8323 , HOH 0:9866	BINDING SITE FOR RESIDUE MG 0 8026
046	CD1	SOFTWARE	A 0:1317 , SER Y:207	BINDING SITE FOR RESIDUE SR 0 9002
047	CD2	SOFTWARE	G 0:2102 , A 0:2103	BINDING SITE FOR RESIDUE SR 0 9004
048	CD3	SOFTWARE	G 0:2639	BINDING SITE FOR RESIDUE SR 0 9006
049	CD4	SOFTWARE	G 0:1376 , A 0:1693 , HOH 0:4970	BINDING SITE FOR RESIDUE SR 0 9007
050	CD5	SOFTWARE	U 0:1368 , HOH 0:5359 , HOH R:8959 , HOH R:8960	BINDING SITE FOR RESIDUE SR 0 9008
051	CD6	SOFTWARE	A 9:56 , A 9:57 , HOH 9:9138	BINDING SITE FOR RESIDUE MG 9 8074
052	CD7	SOFTWARE	C 9:40	BINDING SITE FOR RESIDUE NA 9 8543
053	CD8	SOFTWARE	G 9:21 , G 9:22 , U 9:55 , A 9:57 , G 9:58 , C 9:59	BINDING SITE FOR RESIDUE NA 9 8572
054	CD9	SOFTWARE	G 9:78 , G 9:102	BINDING SITE FOR RESIDUE SR 9 8980
055	DC1	SOFTWARE	A 0:2553 , HOH 0:3637 , HOH 0:3713 , HOH 0:4145 , HOH 0:8377 , HOH 0:9574	BINDING SITE FOR RESIDUE MG 0 8027
056	DC2	SOFTWARE	HOH 0:4121 , HOH 0:4146 , HOH 0:4168 , HOH 0:4170 , HOH 0:8325 , HOH 0:9780	BINDING SITE FOR RESIDUE MG 0 8028
057	DC3	SOFTWARE	A 0:114 , U 0:115 , HOH 0:3413 , HOH 0:4458 , HOH 0:5579 , HOH 0:8326 , HOH 0:8327	BINDING SITE FOR RESIDUE MG 0 8029
058	DC4	SOFTWARE	U 0:392 , HOH 0:3193 , HOH 0:4285 , HOH 0:5133 , HOH 0:8379	BINDING SITE FOR RESIDUE MG 0 8030
059	DC5	SOFTWARE	C 0:195 , G 0:196 , A 0:227 , C 0:228 , HOH 0:4599 , HOH 0:4693 , HOH 0:5856	BINDING SITE FOR RESIDUE MG 0 8031
060	DC6	SOFTWARE	U 0:1309 , U 0:1346 , HOH 0:4154 , HOH 0:4910 , HOH 0:8328 , HOH 0:9937	BINDING SITE FOR RESIDUE MG 0 8032
061	DC7	SOFTWARE	G 0:816 , G 0:817 , HOH 0:3315 , HOH 0:7869 , MG 0:8083 , HOH 0:8381	BINDING SITE FOR RESIDUE MG 0 8033
062	DC8	SOFTWARE	C 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3796 , GLY R:65 , HOH R:8999	BINDING SITE FOR RESIDUE MG 0 8034
063	DC9	SOFTWARE	G 0:1979 , HOH 0:8329 , HOH 0:8382 , HOH 0:8383 , HOH 0:8384	BINDING SITE FOR RESIDUE MG 0 8035
064	DD1	SOFTWARE	A 9:44 , HOH 9:9032 , HOH 9:9082 , HOH 9:9107	BINDING SITE FOR RESIDUE SR 9 9003
065	DD2	SOFTWARE	HOH 0:4462 , HOH A:8988 , HOH A:9002 , HOH A:9016 , HOH A:9063 , HOH A:9092	BINDING SITE FOR RESIDUE MG A 8050
066	DD3	SOFTWARE	G 0:1873 , HOH 0:4840 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120	BINDING SITE FOR RESIDUE MG A 8051
067	DD4	SOFTWARE	LYS A:178	BINDING SITE FOR RESIDUE CL A 8809
068	DD5	SOFTWARE	A 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9022 , HOH A:9095	BINDING SITE FOR RESIDUE SR A 8929
069	DD6	SOFTWARE	HOH 0:4840 , HOH 0:6411 , HOH 0:8420 , ASP A:26 , GLU A:28	BINDING SITE FOR RESIDUE SR A 8930
070	DD7	SOFTWARE	GLU A:28	BINDING SITE FOR RESIDUE SR A 8977
071	DD8	SOFTWARE	HOH 0:4253 , HOH 0:6886 , HOH 0:8236 , HOH B:9021 , HOH B:9135 , HOH B:9136	BINDING SITE FOR RESIDUE MG B 8042
072	DD9	SOFTWARE	HOH 0:3084 , ARG B:223 , LYS B:224 , HIS B:227	BINDING SITE FOR RESIDUE CL B 8819
073	EC1	SOFTWARE	G 0:1794 , HOH 0:7750 , HOH 0:8385 , HOH 0:8386	BINDING SITE FOR RESIDUE MG 0 8036
074	EC2	SOFTWARE	A 0:1098 , HOH 0:6743 , HOH 0:8400	BINDING SITE FOR RESIDUE MG 0 8037
075	EC3	SOFTWARE	C 0:2248 , HOH 0:7775	BINDING SITE FOR RESIDUE MG 0 8038
076	EC4	SOFTWARE	G 0:641 , A 0:1355 , HOH 0:4594 , HOH 0:8330 , HOH 0:8331	BINDING SITE FOR RESIDUE MG 0 8039
077	EC5	SOFTWARE	U 0:1125 , HOH 0:4119 , HOH 0:8404 , G 9:92 , HOH 9:9010 , HOH 9:9039	BINDING SITE FOR RESIDUE MG 0 8040
078	EC6	SOFTWARE	C 0:162 , U 0:2276 , HOH 0:8284 , HOH 0:8332 , HOH 0:8333 , HOH 0:9933	BINDING SITE FOR RESIDUE MG 0 8041
079	EC7	SOFTWARE	A 0:2757 , HOH 0:4165 , HOH 0:4467 , HOH 0:8351 , ASN B:335 , HOH B:9010	BINDING SITE FOR RESIDUE MG 0 8043
080	EC8	SOFTWARE	U 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5492 , GLN A:207 , HOH A:9093	BINDING SITE FOR RESIDUE MG 0 8044
081	EC9	SOFTWARE	G 0:2013 , HOH 0:4259 , HOH 0:8334 , HOH 0:8335 , HOH A:9091 , HOH A:9093	BINDING SITE FOR RESIDUE MG 0 8045
082	ED1	SOFTWARE	HOH 0:3451 , HOH 0:3748 , ASN B:243 , SER B:245	BINDING SITE FOR RESIDUE SR B 8950
083	ED2	SOFTWARE	C 0:2672 , ARG B:25 , PHE B:26 , ARG B:310	BINDING SITE FOR RESIDUE SR B 8987
084	ED3	SOFTWARE	ASP C:45 , THR C:94 , GLU C:95 , LYS C:96	BINDING SITE FOR RESIDUE NA C 8503
085	ED4	SOFTWARE	HOH 0:5583	BINDING SITE FOR RESIDUE SR F 9005
086	ED5	SOFTWARE	C 0:2287 , ARG H:117	BINDING SITE FOR RESIDUE NA H 8518
087	ED6	SOFTWARE	A 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , THR H:161 , PRO H:162	BINDING SITE FOR RESIDUE SR H 8972
088	ED7	SOFTWARE	HOH 0:6237 , HOH 0:9984 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69	BINDING SITE FOR RESIDUE NA J 8538
089	ED8	SOFTWARE	ILE J:127 , LYS J:128	BINDING SITE FOR RESIDUE CL J 8801
090	ED9	SOFTWARE	PRO J:88 , LYS J:90	BINDING SITE FOR RESIDUE CL J 8802
091	FC1	SOFTWARE	G 0:2618 , HOH 0:4218 , HOH 0:4545 , HOH 0:9536 , HOH 0:9540	BINDING SITE FOR RESIDUE MG 0 8046
092	FC2	SOFTWARE	G 0:175 , U 0:224 , G 0:393 , HOH 0:8336 , HOH 0:8337 , HOH 0:8338 , HOH 0:9668	BINDING SITE FOR RESIDUE MG 0 8047
093	FC3	SOFTWARE	A 0:1369 , U 0:2650 , HOH 0:3322 , HOH 0:8339 , HOH 0:8340 , HOH 0:8341	BINDING SITE FOR RESIDUE MG 0 8048
094	FC4	SOFTWARE	HOH 0:4673 , HOH 0:7468 , HOH 0:7885 , HOH 0:8277 , HOH 0:8350	BINDING SITE FOR RESIDUE MG 0 8049
095	FC5	SOFTWARE	A 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8343 , ASN A:188 , ARG A:190	BINDING SITE FOR RESIDUE MG 0 8052
096	FC6	SOFTWARE	A 0:2568 , HOH 0:3235 , HOH 0:4247 , HOH 0:5309 , HOH 0:6694 , HOH 0:7134 , HOH 0:8406	BINDING SITE FOR RESIDUE MG 0 8053
097	FC7	SOFTWARE	A 0:166 , G 0:219 , HOH 0:4310 , HOH 0:5440 , HOH 0:6072 , HOH 0:9620	BINDING SITE FOR RESIDUE MG 0 8055
098	FC8	SOFTWARE	U 0:954 , C 0:2298 , HOH 0:4490 , HOH 0:7868 , HOH 0:8347 , HOH 0:8407	BINDING SITE FOR RESIDUE MG 0 8056
099	FC9	SOFTWARE	A 0:1286 , A 0:1287 , HOH 0:8344 , HOH 0:8345 , HOH 0:8408 , HOH W:7874	BINDING SITE FOR RESIDUE MG 0 8058
100	FD1	SOFTWARE	HOH 0:6237 , GLY J:64 , ASN J:65 , GLY J:68 , TYR J:69	BINDING SITE FOR RESIDUE CL J 8821
101	FD2	SOFTWARE	HOH 0:3919 , HOH 0:4731 , HOH 0:6519 , ASN K:42 , HOH K:2121 , HOH K:7871	BINDING SITE FOR RESIDUE MG K 8054
102	FD3	SOFTWARE	ARG L:53	BINDING SITE FOR RESIDUE CL L 8810
103	FD4	SOFTWARE	SER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:8924	BINDING SITE FOR RESIDUE NA M 8539
104	FD5	SOFTWARE	SER M:106 , ARG M:113 , VAL M:114 , VAL M:159	BINDING SITE FOR RESIDUE CL M 8818
105	FD6	SOFTWARE	LYS D:146 , ARG N:37 , LYS N:38 , ASN N:107	BINDING SITE FOR RESIDUE CL N 8807
106	FD7	SOFTWARE	HOH 0:6492 , HOH 0:6721 , HIS O:40	BINDING SITE FOR RESIDUE CD O 8705
107	FD8	SOFTWARE	HOH 0:7492 , ASN O:44	BINDING SITE FOR RESIDUE CL O 8808
108	FD9	SOFTWARE	ASN Q:16 , ASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427	BINDING SITE FOR RESIDUE NA Q 8540
109	GC1	SOFTWARE	A 0:907 , A 0:908 , HOH 0:4133 , HOH 0:4408 , HOH 0:5418 , HOH 0:8346	BINDING SITE FOR RESIDUE MG 0 8059
110	GC2	SOFTWARE	HOH 0:7313 , HOH 0:8352 , HOH 0:8353 , HOH 0:8409 , HOH 0:8410 , HOH 2:7875	BINDING SITE FOR RESIDUE MG 0 8060
111	GC3	SOFTWARE	A 0:165 , A 0:167 , C 0:168 , HOH 0:4107 , HOH 0:4112 , HOH 0:4124	BINDING SITE FOR RESIDUE MG 0 8061
112	GC4	SOFTWARE	A 0:1684 , U 0:1724 , HOH 0:4697 , HOH 0:4981 , HOH 0:8356 , HOH 0:8413	BINDING SITE FOR RESIDUE MG 0 8062
113	GC5	SOFTWARE	C 0:1436 , A 0:1437 , HOH 0:5637 , HOH 0:5721 , HOH 0:8421	BINDING SITE FOR RESIDUE MG 0 8063
114	GC6	SOFTWARE	A 0:1754 , HOH 0:4204 , HOH 0:4644 , HOH 0:6828 , HOH 0:8357 , HOH 0:8414	BINDING SITE FOR RESIDUE MG 0 8064
115	GC7	SOFTWARE	A 0:1742 , HOH 0:3254 , HOH 0:4130 , HOH 0:8358 , HOH 0:9749 , HOH 0:9873	BINDING SITE FOR RESIDUE MG 0 8065
116	GC8	SOFTWARE	G 0:2617 , G 0:2618 , HOH 0:3104 , HOH 0:4283 , HOH 0:4848 , HOH 0:4974 , HOH 0:9536	BINDING SITE FOR RESIDUE MG 0 8066
117	GC9	SOFTWARE	G 0:2540 , G 0:2611 , HOH 0:3546 , HOH 0:4781 , NA 0:8534 , HOH 0:9561	BINDING SITE FOR RESIDUE MG 0 8067
118	GD1	SOFTWARE	SER R:70 , VAL R:72 , HOH R:8928 , HOH R:8930 , HOH R:8964	BINDING SITE FOR RESIDUE NA R 8532
119	GD2	SOFTWARE	U 0:12 , LYS R:60 , GLN R:61 , ASN R:63 , SR R:8912	BINDING SITE FOR RESIDUE NA R 8575
120	GD3	SOFTWARE	HOH 0:9834 , LYS R:118	BINDING SITE FOR RESIDUE CL R 8806
121	GD4	SOFTWARE	GLN R:61 , ASN R:63 , NA R:8575	BINDING SITE FOR RESIDUE SR R 8912
122	GD5	SOFTWARE	HIS S:7 , GLU S:61 , HOH S:8973	BINDING SITE FOR RESIDUE NA S 8510
123	GD6	SOFTWARE	HOH 0:5796 , ASP S:59	BINDING SITE FOR RESIDUE SR S 8961
124	GD7	SOFTWARE	GLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868	BINDING SITE FOR RESIDUE MG T 8057
125	GD8	SOFTWARE	CYS U:6 , CYS U:9 , CYS U:32 , CYS U:36	BINDING SITE FOR RESIDUE CD U 8701
126	GD9	SOFTWARE	HIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:8859 , HOH Y:8880 , HOH Y:8915	BINDING SITE FOR RESIDUE MG Y 8086
127	HC1	SOFTWARE	C 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:8361 , HOH 0:8415 , HOH 0:8416	BINDING SITE FOR RESIDUE MG 0 8068
128	HC2	SOFTWARE	A 0:2103 , U 0:2478 , HOH 0:4110 , HOH 0:4290 , HOH 0:6457	BINDING SITE FOR RESIDUE MG 0 8069
129	HC3	SOFTWARE	G 0:918 , C 0:2294 , HOH 0:3049 , HOH 0:3824 , HOH 0:6950 , HOH 0:8362 , HOH 0:9588	BINDING SITE FOR RESIDUE MG 0 8070
130	HC4	SOFTWARE	A 0:1843 , C 0:1844 , HOH 0:4141 , HOH 0:8417	BINDING SITE FOR RESIDUE MG 0 8071
131	HC5	SOFTWARE	A 0:1070 , G 0:1071 , HOH 0:3186 , HOH 0:4147 , HOH 0:4179 , HOH 0:4219	BINDING SITE FOR RESIDUE MG 0 8072
132	HC6	SOFTWARE	U 0:1096 , C 0:1257 , HOH 0:8363 , HOH 0:8418	BINDING SITE FOR RESIDUE MG 0 8073
133	HC7	SOFTWARE	G 0:1848 , G 0:1849 , HOH 0:4160 , HOH 0:4197 , HOH 0:4328 , HOH 0:4359	BINDING SITE FOR RESIDUE MG 0 8075
134	HC8	SOFTWARE	G 0:863 , U 0:864 , HOH 0:3840 , HOH 0:4169 , HOH 0:4173 , HOH 0:6033	BINDING SITE FOR RESIDUE MG 0 8076
135	HC9	SOFTWARE	A 0:907 , HOH 0:3444 , HOH 0:3868 , HOH 0:4181 , HOH 0:4243 , HOH Y:8867	BINDING SITE FOR RESIDUE MG 0 8077
136	HD1	SOFTWARE	G 0:1269 , HOH 0:5418 , ARG Y:169	BINDING SITE FOR RESIDUE CL Y 8820
137	HD2	SOFTWARE	CYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60	BINDING SITE FOR RESIDUE CD Z 8703
138	HD3	SOFTWARE	CYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37	BINDING SITE FOR RESIDUE CD 1 8702
139	HD4	SOFTWARE	U 0:862 , HOH 0:5368 , HOH 0:9666 , LYS 1:10 , ASN 1:12 , HOH 1:8990	BINDING SITE FOR RESIDUE SR 1 8913
140	HD5	SOFTWARE	HOH 0:3278 , HOH 0:3731 , HOH 0:4376 , HOH 0:9799 , ASP 1:47 , HOH 1:8976	BINDING SITE FOR RESIDUE SR 1 8952
141	HD6	SOFTWARE	CYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74	BINDING SITE FOR RESIDUE CD 3 8704
142	HD7	SOFTWARE	ASP 3:66	BINDING SITE FOR RESIDUE CL 3 8804
143	HD8	SOFTWARE	HOH 0:4450 , HOH 0:8411 , HOH 0:8412 , GLY 3:45 , GLY 3:47 , ASP 3:49	BINDING SITE FOR RESIDUE SR 3 8932
144	IC1	SOFTWARE	A 0:2612 , HOH 0:3515 , HOH 0:4164 , HOH 0:4176	BINDING SITE FOR RESIDUE MG 0 8078
145	IC2	SOFTWARE	U 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4242 , HOH 0:5111 , HOH 0:7369	BINDING SITE FOR RESIDUE MG 0 8079
146	IC3	SOFTWARE	A 0:2434 , U 0:2458 , HOH 0:3395 , HOH 0:8426 , HOH 0:9752 , HOH 3:8950	BINDING SITE FOR RESIDUE MG 0 8080
147	IC4	SOFTWARE	A 0:2577 , G 0:2578 , G 0:2579 , HOH 0:8419	BINDING SITE FOR RESIDUE MG 0 8081
148	IC5	SOFTWARE	C 0:2104 , C 0:2105 , HOH 0:8274	BINDING SITE FOR RESIDUE MG 0 8082
149	IC6	SOFTWARE	G 0:817 , HOH 0:4096 , HOH 0:7864 , HOH 0:7869 , MG 0:8033 , HOH 0:8381 , HOH P:185	BINDING SITE FOR RESIDUE MG 0 8083
150	IC7	SOFTWARE	A 0:1106 , A 0:1107 , HOH 0:8390 , HOH 0:8391 , HOH 0:8392 , HOH 0:8393	BINDING SITE FOR RESIDUE MG 0 8084
151	IC8	SOFTWARE	HOH 0:6570 , HOH 0:7939 , HOH 0:8395 , HOH 0:8396 , HOH 0:8397	BINDING SITE FOR RESIDUE MG 0 8085
152	IC9	SOFTWARE	U 0:903 , A 0:1357 , HOH 0:3010 , HOH 0:4418 , HOH 0:5880 , HOH 0:6508	BINDING SITE FOR RESIDUE MG 0 8087
153	JC1	SOFTWARE	A 0:187 , HOH 0:3071 , HOH 0:4222 , HOH 0:4263 , HOH 0:9626 , HOH 0:9828	BINDING SITE FOR RESIDUE MG 0 8088
154	JC2	SOFTWARE	A 0:2112 , HOH 0:3092 , HOH 0:4248 , HOH 0:4416 , HOH 0:6602 , HOH 0:6868	BINDING SITE FOR RESIDUE MG 0 8089
155	JC3	SOFTWARE	A 0:2430 , HOH 0:4457 , HOH 0:5305 , HOH 0:9848 , HOH 0:9951	BINDING SITE FOR RESIDUE MG 0 8090
156	JC4	SOFTWARE	HOH 0:4774 , HOH 0:4790 , HOH 0:6878 , HOH 0:7066 , HOH 0:7197 , MG 0:8092 , HOH A:9019 , HOH A:9094	BINDING SITE FOR RESIDUE MG 0 8091
157	JC5	SOFTWARE	U 0:1850 , HOH 0:4160 , HOH 0:4186 , HOH 0:4359 , HOH 0:7197 , MG 0:8091 , HOH A:9019	BINDING SITE FOR RESIDUE MG 0 8092
158	JC6	SOFTWARE	A 0:1840 , C 0:1841 , A 0:2022 , HOH 0:5126 , HOH 0:7025 , HOH 0:9725	BINDING SITE FOR RESIDUE MG 0 8093
159	JC7	SOFTWARE	G 0:2102 , G 0:2482 , C 0:2536	BINDING SITE FOR RESIDUE K 0 8401
160	JC8	SOFTWARE	C 0:162 , U 0:163 , U 0:172 , HOH 0:9513 , HOH 0:9608 , ARG M:82	BINDING SITE FOR RESIDUE K 0 8402
161	JC9	SOFTWARE	C 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3671 , HOH 0:3702 , HOH 0:5452	BINDING SITE FOR RESIDUE NA 0 8501
162	KC1	SOFTWARE	G 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:8307	BINDING SITE FOR RESIDUE NA 0 8502
163	KC2	SOFTWARE	A 0:630 , A 0:631 , A 0:2074 , HOH 0:4580 , HOH 0:5190 , HOH 0:6265	BINDING SITE FOR RESIDUE NA 0 8504
164	KC3	SOFTWARE	G 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9624	BINDING SITE FOR RESIDUE NA 0 8505
165	KC4	SOFTWARE	C 0:40 , G 0:41 , A 0:442 , C 0:443	BINDING SITE FOR RESIDUE NA 0 8506
166	KC5	SOFTWARE	C 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:3909 , SR 0:8962	BINDING SITE FOR RESIDUE NA 0 8507
167	KC6	SOFTWARE	A 0:2577 , G 0:2578 , G 0:2579 , HOH 0:4993	BINDING SITE FOR RESIDUE NA 0 8508
168	KC7	SOFTWARE	G 0:2524 , G 0:2525 , HOH 0:4072 , HOH 0:5144	BINDING SITE FOR RESIDUE NA 0 8509
169	KC8	SOFTWARE	G 0:2399 , HOH 0:3455 , HOH 0:4329 , HOH 0:5552 , HOH 0:5599	BINDING SITE FOR RESIDUE NA 0 8511
170	KC9	SOFTWARE	U 0:2541 , U 0:2607 , HOH 0:3632 , HOH 0:9829 , TRP B:242	BINDING SITE FOR RESIDUE NA 0 8512
171	LC1	SOFTWARE	A 0:165 , A 0:166 , A 0:167 , HOH 0:3189	BINDING SITE FOR RESIDUE NA 0 8513
172	LC2	SOFTWARE	C 0:896 , A 0:897 , HOH 0:6786 , HOH 0:8209	BINDING SITE FOR RESIDUE NA 0 8514
173	LC3	SOFTWARE	G 0:1416 , G 0:1417 , HOH 0:9775 , TRP 2:42 , ASN 2:45 , HOH 2:4135	BINDING SITE FOR RESIDUE NA 0 8515
174	LC4	SOFTWARE	G 0:2543 , G 0:2544 , HOH 0:3961 , HOH 0:4422 , HOH 0:7949 , NA 0:8517 , HOH 0:9711	BINDING SITE FOR RESIDUE NA 0 8516
175	LC5	SOFTWARE	G 0:2543 , G 0:2544 , G 0:2611 , U 0:2615 , HOH 0:3245 , NA 0:8516 , HOH 0:9583	BINDING SITE FOR RESIDUE NA 0 8517
176	LC6	SOFTWARE	G 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:4968	BINDING SITE FOR RESIDUE NA 0 8519
177	LC7	SOFTWARE	C 0:130 , U 0:146 , G 0:147 , HOH 0:4620 , HOH 0:9994	BINDING SITE FOR RESIDUE NA 0 8520
178	LC8	SOFTWARE	A 0:776 , U 0:777 , U 0:779 , HOH 0:3127 , HOH 0:3777 , HOH 0:8186 , SR 0:8934	BINDING SITE FOR RESIDUE NA 0 8521
179	LC9	SOFTWARE	G 0:1971 , G 0:2009 , A 0:2010 , U 0:2012	BINDING SITE FOR RESIDUE NA 0 8522
180	MC1	SOFTWARE	U 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3231 , HOH 0:3707 , HOH 0:9535	BINDING SITE FOR RESIDUE NA 0 8523
181	MC2	SOFTWARE	G 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5693 , HOH 0:6945	BINDING SITE FOR RESIDUE NA 0 8524
182	MC3	SOFTWARE	G 0:66 , U 0:107 , U 0:108 , HOH 0:7044	BINDING SITE FOR RESIDUE NA 0 8525
183	MC4	SOFTWARE	G 0:140 , C 0:141 , G 0:142 , HOH 0:9735	BINDING SITE FOR RESIDUE NA 0 8526
184	MC5	SOFTWARE	U 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:9798	BINDING SITE FOR RESIDUE NA 0 8527
185	MC6	SOFTWARE	G 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7534	BINDING SITE FOR RESIDUE NA 0 8528
186	MC7	SOFTWARE	C 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5727 , HOH 0:8429	BINDING SITE FOR RESIDUE NA 0 8529
187	MC8	SOFTWARE	C 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3375	BINDING SITE FOR RESIDUE NA 0 8530
188	MC9	SOFTWARE	G 0:1706 , G 0:1707 , HOH 0:3427 , HOH 0:5818 , HOH 0:7803 , HOH 0:8212	BINDING SITE FOR RESIDUE NA 0 8531
189	NC1	SOFTWARE	U 0:2659 , G 0:2660 , VAL R:72 , TRP R:75 , HOH R:8919 , HOH R:8930	BINDING SITE FOR RESIDUE NA 0 8533
190	NC2	SOFTWARE	G 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , HOH 0:3530 , HOH 0:4781 , MG 0:8067	BINDING SITE FOR RESIDUE NA 0 8534
191	NC3	SOFTWARE	U 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3538 , HOH 0:6748	BINDING SITE FOR RESIDUE NA 0 8535
192	NC4	SOFTWARE	G 0:681 , A 0:682 , G 0:683 , HOH 0:8422	BINDING SITE FOR RESIDUE NA 0 8536
193	NC5	SOFTWARE	U 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124	BINDING SITE FOR RESIDUE NA 0 8537
194	NC6	SOFTWARE	A 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045	BINDING SITE FOR RESIDUE NA 0 8541
195	NC7	SOFTWARE	U 0:623 , U 0:624 , G 0:901 , HOH 0:7423	BINDING SITE FOR RESIDUE NA 0 8542
196	NC8	SOFTWARE	A 0:955 , HOH 0:7070 , C 9:81 , U 9:82	BINDING SITE FOR RESIDUE NA 0 8544
197	NC9	SOFTWARE	U 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5306	BINDING SITE FOR RESIDUE NA 0 8545
198	OC1	SOFTWARE	G 0:1119 , C 0:1243 , HOH 0:5298 , THR J:47	BINDING SITE FOR RESIDUE NA 0 8546
199	OC2	SOFTWARE	C 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:9954	BINDING SITE FOR RESIDUE NA 0 8547
200	OC3	SOFTWARE	G 0:941 , U 0:942 , G 0:1024 , HOH 0:6747	BINDING SITE FOR RESIDUE NA 0 8548
201	OC4	SOFTWARE	G 0:2611 , HOH 0:9985 , TRP B:242	BINDING SITE FOR RESIDUE NA 0 8549
202	OC5	SOFTWARE	G 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109 , HOH 0:6134	BINDING SITE FOR RESIDUE NA 0 8550
203	OC6	SOFTWARE	A 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6433	BINDING SITE FOR RESIDUE NA 0 8551
204	OC7	SOFTWARE	U 0:837 , HOH 0:5079 , HOH 0:5388 , HOH 0:5578 , HOH 0:7792 , GLN B:230	BINDING SITE FOR RESIDUE NA 0 8552
205	OC8	SOFTWARE	A 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277 , HOH 0:5787	BINDING SITE FOR RESIDUE NA 0 8553
206	OC9	SOFTWARE	U 0:1359 , C 0:1360 , HOH 0:3974 , HOH 0:7507	BINDING SITE FOR RESIDUE NA 0 8554
207	PC1	SOFTWARE	U 0:2057 , G 0:2058 , HOH 0:3318	BINDING SITE FOR RESIDUE NA 0 8555
208	PC2	SOFTWARE	U 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194	BINDING SITE FOR RESIDUE NA 0 8556
209	PC3	SOFTWARE	G 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3369 , HOH 0:3388 , HOH 0:4315 , HOH 0:4375	BINDING SITE FOR RESIDUE NA 0 8557
210	PC4	SOFTWARE	G 0:464 , G 0:475 , HOH 0:3332 , HOH 0:5092 , ARG C:55 , HOH C:8588	BINDING SITE FOR RESIDUE NA 0 8558
211	PC5	SOFTWARE	G 0:798 , G 0:814 , U 0:815	BINDING SITE FOR RESIDUE NA 0 8559
212	PC6	SOFTWARE	U 0:391 , U 0:392 , A 0:395 , U 0:398 , HOH 0:7038	BINDING SITE FOR RESIDUE NA 0 8560
213	PC7	SOFTWARE	G 0:1832 , A 0:2022 , HOH 0:4593 , HOH 0:9600	BINDING SITE FOR RESIDUE NA 0 8561
214	PC8	SOFTWARE	G 0:2491 , U 0:2492 , G 0:2529 , C 0:2530 , HOH 0:3128	BINDING SITE FOR RESIDUE NA 0 8562
215	PC9	SOFTWARE	U 0:919 , G 0:921 , G 0:924 , HOH 0:9771	BINDING SITE FOR RESIDUE NA 0 8563
216	QC1	SOFTWARE	G 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:4177 , HOH 0:7754	BINDING SITE FOR RESIDUE NA 0 8564
217	QC2	SOFTWARE	C 0:195 , G 0:196 , A 0:415 , G 0:416	BINDING SITE FOR RESIDUE NA 0 8565
218	QC3	SOFTWARE	G 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9763	BINDING SITE FOR RESIDUE NA 0 8566
219	QC4	SOFTWARE	G 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:6815	BINDING SITE FOR RESIDUE NA 0 8567
220	QC5	SOFTWARE	C 0:762 , G 0:902 , U 0:903 , HOH 0:3711 , HIS L:18 , HOH L:8826 , HOH L:8844	BINDING SITE FOR RESIDUE NA 0 8568
221	QC6	SOFTWARE	U 0:831 , U 0:832 , G 0:833 , HOH 0:4210 , HOH 0:4917	BINDING SITE FOR RESIDUE NA 0 8569
222	QC7	SOFTWARE	G 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4188 , HOH 0:7536 , HOH 0:9827	BINDING SITE FOR RESIDUE NA 0 8570
223	QC8	SOFTWARE	G 0:2772 , G 0:2773	BINDING SITE FOR RESIDUE NA 0 8571
224	QC9	SOFTWARE	C 0:197 , HOH 0:5500 , HOH 0:5730 , HOH 0:7037	BINDING SITE FOR RESIDUE NA 0 8573
225	RC1	SOFTWARE	G 0:1077 , A 0:1079 , HOH 0:8205	BINDING SITE FOR RESIDUE NA 0 8574
226	RC2	SOFTWARE	G 0:1452 , G 0:1676 , LYS 2:2	BINDING SITE FOR RESIDUE CL 0 8803
227	RC3	SOFTWARE	C 0:197 , G 0:201 , G 0:229	BINDING SITE FOR RESIDUE CL 0 8805
228	RC4	SOFTWARE	C 0:2388 , HOH 0:3665 , PHE Q:52 , HIS Q:53	BINDING SITE FOR RESIDUE CL 0 8811
229	RC5	SOFTWARE	G 0:2582 , A 0:2596 , HOH 0:5576 , LYS K:14 , ILE K:32 , SER K:33	BINDING SITE FOR RESIDUE CL 0 8812
230	RC6	SOFTWARE	A 0:1328 , G 0:1329 , HOH 0:5149	BINDING SITE FOR RESIDUE CL 0 8813
231	RC7	SOFTWARE	G 0:644 , HIS L:13 , HOH L:8880	BINDING SITE FOR RESIDUE CL 0 8814
232	RC8	SOFTWARE	A 0:1597 , A 0:1598 , G 0:1646	BINDING SITE FOR RESIDUE CL 0 8815
233	RC9	SOFTWARE	G 0:1119 , C 0:1243 , LYS J:56	BINDING SITE FOR RESIDUE CL 0 8816
234	SC1	SOFTWARE	C 0:594 , U 0:595 , HOH Y:8853	BINDING SITE FOR RESIDUE CL 0 8817
235	SC2	SOFTWARE	G 0:1072 , G 0:1087 , A 0:1291	BINDING SITE FOR RESIDUE CL 0 8822
236	SC3	SOFTWARE	G 0:824 , G 0:854 , HOH 0:4451 , HOH 0:4779 , HOH 0:4913 , HOH 0:5018	BINDING SITE FOR RESIDUE SR 0 8901
237	SC4	SOFTWARE	G 0:836 , U 0:2615 , HOH 0:4333 , HOH 0:9861 , GLN B:230 , HOH B:8994	BINDING SITE FOR RESIDUE SR 0 8902
238	SC5	SOFTWARE	G 0:1489 , G 0:1491 , HOH 0:4128 , HOH 0:4449 , HOH 0:6644 , HOH 0:9897	BINDING SITE FOR RESIDUE SR 0 8903
239	SC6	SOFTWARE	A 0:643 , C 0:1353 , G 0:1354 , HOH 0:7047 , HOH 0:8432 , HOH 0:9931	BINDING SITE FOR RESIDUE SR 0 8904
240	SC7	SOFTWARE	A 0:1754 , A 0:1755 , HOH 0:7055 , HOH 0:7625 , HOH 0:8117	BINDING SITE FOR RESIDUE SR 0 8905
241	SC8	SOFTWARE	C 0:893 , HOH 0:6107 , HOH 0:8431 , HOH C:8547	BINDING SITE FOR RESIDUE SR 0 8906
242	SC9	SOFTWARE	G 0:1055 , HOH 0:4321 , HOH 0:5315 , HOH 0:6803 , ASP H:13 , HOH H:8991	BINDING SITE FOR RESIDUE SR 0 8907
243	TC1	SOFTWARE	U 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:8939	BINDING SITE FOR RESIDUE SR 0 8908
244	TC2	SOFTWARE	HOH 0:4262 , HOH 0:4739 , HOH 0:5986 , HOH 0:6625 , HOH 0:7059 , HOH 0:7353	BINDING SITE FOR RESIDUE SR 0 8909
245	TC3	SOFTWARE	A 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3179	BINDING SITE FOR RESIDUE SR 0 8910
246	TC4	SOFTWARE	C 0:85 , A 0:86 , C 0:87 , ASP T:68 , HOH T:4403	BINDING SITE FOR RESIDUE SR 0 8911
247	TC5	SOFTWARE	HOH 0:4642 , HOH 0:5364 , HOH 0:5697	BINDING SITE FOR RESIDUE SR 0 8914
248	TC6	SOFTWARE	U 0:664 , G 0:681 , HOH 0:7392 , HOH C:8540	BINDING SITE FOR RESIDUE SR 0 8915
249	TC7	SOFTWARE	C 0:1420 , C 0:1421 , G 0:1438 , HOH 0:6250	BINDING SITE FOR RESIDUE SR 0 8916
250	TC8	SOFTWARE	U 0:454 , C 0:478 , HOH 0:6127	BINDING SITE FOR RESIDUE SR 0 8917
251	TC9	SOFTWARE	A 0:1504 , A 0:1678 , C 0:1679 , HOH 0:4241 , HOH 0:8296 , HOH 0:8315	BINDING SITE FOR RESIDUE SR 0 8918
252	UC1	SOFTWARE	G 0:2543 , C 0:2608	BINDING SITE FOR RESIDUE SR 0 8919
253	UC2	SOFTWARE	G 0:2632 , HOH 0:5032	BINDING SITE FOR RESIDUE SR 0 8920
254	UC3	SOFTWARE	A 0:1717 , G 0:1718 , HOH 0:5042 , HOH 0:5822 , HOH 0:6855	BINDING SITE FOR RESIDUE SR 0 8921
255	UC4	SOFTWARE	G 0:471 , HOH 0:3542 , HOH 0:4889 , HOH 0:6097 , HOH 0:9702 , HOH 0:9742	BINDING SITE FOR RESIDUE SR 0 8922
256	UC5	SOFTWARE	G 0:1059 , C 0:1127 , HOH 0:4317 , HOH 0:5354 , HOH 0:5794 , HOH 0:9612	BINDING SITE FOR RESIDUE SR 0 8923
257	UC6	SOFTWARE	G 0:2725 , G 0:2755 , HOH 0:3216 , HOH 0:4308 , HOH 0:6813 , HOH 0:7138	BINDING SITE FOR RESIDUE SR 0 8924
258	UC7	SOFTWARE	G 0:503	BINDING SITE FOR RESIDUE SR 0 8925
259	UC8	SOFTWARE	HOH 0:3841 , HOH 0:6261 , HOH 0:6916	BINDING SITE FOR RESIDUE SR 0 8926
260	UC9	SOFTWARE	A 0:2553 , HOH 0:4145	BINDING SITE FOR RESIDUE SR 0 8927
261	VC1	SOFTWARE	U 0:1109 , G 0:1110 , A 0:1247 , HOH 0:3950 , HOH 0:7433	BINDING SITE FOR RESIDUE SR 0 8928
262	VC2	SOFTWARE	G 0:1543 , HOH 0:6557 , HOH 0:6569	BINDING SITE FOR RESIDUE SR 0 8931
263	VC3	SOFTWARE	A 0:532 , U 0:533 , HOH 0:4228 , HOH 0:4468 , HOH 0:8360	BINDING SITE FOR RESIDUE SR 0 8933
264	VC4	SOFTWARE	U 0:777 , C 0:778 , HOH 0:3777 , MG 0:8024 , HOH 0:8317 , NA 0:8521	BINDING SITE FOR RESIDUE SR 0 8934
265	VC5	SOFTWARE	G 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8388 , HOH 0:8389	BINDING SITE FOR RESIDUE SR 0 8935
266	VC6	SOFTWARE	A 0:1291 , G 0:1292 , HOH 0:3723 , HOH 0:4109 , HOH 0:7912 , HOH 0:8369	BINDING SITE FOR RESIDUE SR 0 8936
267	VC7	SOFTWARE	HOH 0:4782 , HOH 0:6967 , HOH 0:7981	BINDING SITE FOR RESIDUE SR 0 8937
268	VC8	SOFTWARE	HOH 0:5499 , HOH 0:5661	BINDING SITE FOR RESIDUE SR 0 8938
269	VC9	SOFTWARE	G 0:84 , C 0:85 , ASP T:68 , HOH T:4403	BINDING SITE FOR RESIDUE SR 0 8939
270	WC1	SOFTWARE	A 0:2465 , G 0:2466 , HOH 0:4749 , HOH 0:8428 , ASP L:36	BINDING SITE FOR RESIDUE SR 0 8940
271	WC2	SOFTWARE	G 0:1683 , U 0:1696 , HOH 0:3288 , HOH 0:5246 , HOH 0:5326	BINDING SITE FOR RESIDUE SR 0 8941
272	WC3	SOFTWARE	A 0:2746 , U 0:2749 , G 0:2750 , HOH 0:6355 , HOH 0:8425	BINDING SITE FOR RESIDUE SR 0 8942
273	WC4	SOFTWARE	A 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6593	BINDING SITE FOR RESIDUE SR 0 8943
274	WC5	SOFTWARE	U 0:2016 , HOH 0:8096	BINDING SITE FOR RESIDUE SR 0 8944
275	WC6	SOFTWARE	G 0:1484 , HOH 0:4212 , HOH 0:8319 , HOH 0:8320 , HOH 0:8375 , HOH 0:8376	BINDING SITE FOR RESIDUE SR 0 8945
276	WC7	SOFTWARE	G 0:2091 , HOH 0:6578	BINDING SITE FOR RESIDUE SR 0 8946
277	WC8	SOFTWARE	C 0:1690 , HOH 0:5196 , HOH 0:9946	BINDING SITE FOR RESIDUE SR 0 8947
278	WC9	SOFTWARE	A 0:2302 , A 0:2303 , HOH 0:4139 , HOH 0:4265 , HOH 0:5351 , HOH 0:8318	BINDING SITE FOR RESIDUE SR 0 8948
279	XC1	SOFTWARE	U 0:821 , C 0:822 , G 0:854 , HOH 0:3310 , HOH 0:4113 , HOH 0:4249	BINDING SITE FOR RESIDUE SR 0 8949
280	XC2	SOFTWARE	G 0:2696	BINDING SITE FOR RESIDUE SR 0 8951
281	XC3	SOFTWARE	U 0:391 , ARG 3:42 , HOH 3:8970	BINDING SITE FOR RESIDUE SR 0 8953
282	XC4	SOFTWARE	G 0:2810 , HOH 0:8126 , ASN B:27	BINDING SITE FOR RESIDUE SR 0 8954
283	XC5	SOFTWARE	U 0:2557 , HOH 0:3559 , HOH 0:7127	BINDING SITE FOR RESIDUE SR 0 8955
284	XC6	SOFTWARE	A 0:682 , G 0:683 , HOH 0:8422 , HOH 0:8434	BINDING SITE FOR RESIDUE SR 0 8956
285	XC7	SOFTWARE	C 0:1462 , U 0:1463 , GLY 1:40	BINDING SITE FOR RESIDUE SR 0 8957
286	XC8	SOFTWARE	A 0:1133 , G 0:1134 , HOH 0:5280 , HOH 0:9927	BINDING SITE FOR RESIDUE SR 0 8958
287	XC9	SOFTWARE	U 0:1972 , HOH 0:3172 , HOH 0:3803	BINDING SITE FOR RESIDUE SR 0 8959
288	YC1	SOFTWARE	G 0:1113 , HOH 0:4191	BINDING SITE FOR RESIDUE SR 0 8960
289	YC2	SOFTWARE	U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4086 , NA 0:8507	BINDING SITE FOR RESIDUE SR 0 8962
290	YC3	SOFTWARE	G 0:2284 , G 0:2285 , HOH 0:5998 , HOH 0:7661	BINDING SITE FOR RESIDUE SR 0 8963
291	YC4	SOFTWARE	G 0:2777 , HOH 0:4690	BINDING SITE FOR RESIDUE SR 0 8964
292	YC5	SOFTWARE	A 0:1815 , HOH 0:6526 , HOH 0:7873 , HOH 0:7998 , HOH 0:8348 , HOH 0:8349	BINDING SITE FOR RESIDUE SR 0 8965
293	YC6	SOFTWARE	C 0:235 , HOH 0:5191 , HOH 0:5929 , HOH 0:6626 , HOH 0:8050	BINDING SITE FOR RESIDUE SR 0 8966
294	YC7	SOFTWARE	U 0:2690 , HOH 0:3554 , HOH 0:6016	BINDING SITE FOR RESIDUE SR 0 8967
295	YC8	SOFTWARE	G 0:2522 , C 9:91 , HOH H:9012	BINDING SITE FOR RESIDUE SR 0 8968
296	YC9	SOFTWARE	A 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5360 , HOH 0:9713 , GLY L:14 , HOH L:8881	BINDING SITE FOR RESIDUE SR 0 8969
297	ZC1	SOFTWARE	A 0:565 , G 0:592	BINDING SITE FOR RESIDUE SR 0 8970
298	ZC2	SOFTWARE	HOH 0:6920 , HOH 0:7755	BINDING SITE FOR RESIDUE SR 0 8973
299	ZC3	SOFTWARE	U 0:1835 , HOH 0:8130	BINDING SITE FOR RESIDUE SR 0 8974
300	ZC4	SOFTWARE	C 0:1894 , U 0:1897 , G 0:1898 , U 0:1939 , HOH 0:8429	BINDING SITE FOR RESIDUE SR 0 8975
301	ZC5	SOFTWARE	A 0:1375 , G 0:1726	BINDING SITE FOR RESIDUE SR 0 8976
302	ZC6	SOFTWARE	C 0:1129 , HOH 0:4119 , HOH 0:6573 , HOH 0:7381 , HOH 0:8404 , C 9:91 , G 9:92 , HOH 9:9071	BINDING SITE FOR RESIDUE SR 0 8978
303	ZC7	SOFTWARE	U 0:2640	BINDING SITE FOR RESIDUE SR 0 8979
304	ZC8	SOFTWARE	G 0:1290 , A 0:1291 , HOH 0:5445	BINDING SITE FOR RESIDUE SR 0 8981
305	ZC9	SOFTWARE	A 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752	BINDING SITE FOR RESIDUE SR 0 8982

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (26, 26)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1yhq 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1yhq11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1yhq100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1yhq101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1yhq 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1yhq21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1yhq200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1yhq201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1yhq 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1yhq31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1yhq300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1yhq 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1yhq 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1yhqa2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1yhqa1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1yhqA01 A:1-78 Nucleic acid-binding proteins                                  ---1yhqA02 A:82-159  [code=2.30.30.30, no name defined]                          1yhqA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1yhqA02 A:10-82                                             -----Ribosomal_L2_C-1yhqA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeee..........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1yhqb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1yhqB01 B:1-38,B:207-257              1yhqB02 B:39-77,B:189-206,B:258-337    1yhqB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1yhqB02           1yhqB01 B:1-38,B:207-257                           1yhqB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1yhqB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee..eeeeehhhhhhh....hhhhhhh........................eeee..eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1yhqc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1yhqC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1yhqC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1yhqd1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1yhqD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1yhqD0     1 D:11-64                     ---Ribosomal_L5_C-1yhqD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhhh...eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee..hhhhhh........hhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1yhqe1 E:1-79 Ribosomal protein L6                                            d1yhqe2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1yhqE01 E:1-79  [code=3.90.930.12, no name defined]                            1yhqE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1yhqE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1yhqE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1yhqf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1yhqF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1yhqF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh.eeeehhhhhhhhhhhh....eeee.....hhhhhhhhhhhhh....eeee.hhhhhhhhh.......eeeee....hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1yhqg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1yhq G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1yhqh1 H:4-166 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1yhqH00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee..........eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeeehhhhhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1yhqi1 I:66-135 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1yhqI00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1yhqI01 I:66-134                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhh..............eeehhhhhhhhhhhh.......hhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1yhq I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1yhqj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1yhqJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1yhqJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1yhqk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1yhqK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1yhqK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1yhql1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1yhqL01 L:1-50                                    1yhqL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1yhqL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1yhqm1 M:1-193 Ribosomal protein L15e                                                                                                                                                           - SCOP domains
               CATH domains 1yhqM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1yhqM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1yhqn1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1yhqN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1yhqN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1yhqo1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1yhqO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1yhqO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1yhqp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1yhqP01 P:1-55  [code=1.10.1650.10, no name defined]   1yhqP02 P:56-88 Single Heli x bin1yhqP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1yhqq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1yhqQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1yhqQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhh.......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1yhq Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1yhqr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1yhqR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1yhqR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.....eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1yhqs1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1yhqS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1yhqS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1yhq S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1yhqt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1yhqT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1yhqT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1yhqu1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1yhqU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1yhqU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1yhq U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1yhqv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1yhqV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1yhqV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1yhq V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1yhqw1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1yhqW01 W:1-57,W:114-154                                 1yhqW02 W:58-113  [code=1.10.15.30, no name defined]    1yhqW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1yhqW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1yhqx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1yhqX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1yhqX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1yhq X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1yhqy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1yhqY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1yhqz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1yhqZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1yhqZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh.ee......eeeeeee..eeee.....eee.........hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1yhq Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (30, 31)

CATH Domains (32, 36)

Pfam Domains (26, 28)

Gene Ontology (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)

Chain 1 (RL37_HALMA | P32410)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2 (RL39_HALMA | P22452)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3 (RL44E_HALMA | P32411)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A (RL2_HALMA | P20276)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B (RL3_HALMA | P20279)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C (RL4_HALMA | P12735)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D (RL5_HALMA | P14124)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E (RL6_HALMA | P14135)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F (RL7A_HALMA | P12743)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0004526	ribonuclease P activity	Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0090501	RNA phosphodiester bond hydrolysis	The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0001682	tRNA 5'-leader removal	Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G (RL10_HALMA | P15825)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
biological process
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H (RL10E_HALMA | P60617)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I (RL11_HALMA | P14122)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J (RL13_HALMA | P29198)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K (RL14_HALMA | P22450)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L (RL15_HALMA | P12737)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M (RL15E_HALMA | P60618)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N (RL18_HALMA | P14123)

molecular function
	GO:0008097	5S rRNA binding	Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O (RL18E_HALMA | P12733)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P (RL19E_HALMA | P14119)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q (RL21_HALMA | P12734)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R (RL22_HALMA | P10970)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S (RL23_HALMA | P12732)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T (RL24_HALMA | P10972)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U (RL24E_HALMA | P14116)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V (RL29_HALMA | P10971)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W (RL30_HALMA | P14121)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0015934	large ribosomal subunit	The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X (RL31_HALMA | P18138)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y (RL32_HALMA | P12736)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z (RL37A_HALMA | P60619)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0070180	large ribosomal subunit rRNA binding	Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0019843	rRNA binding	Interacting selectively and non-covalently with ribosomal RNA.
	GO:0003735	structural constituent of ribosome	The action of a molecule that contributes to the structural integrity of the ribosome.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		1MA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OMG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OMU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PSU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UR3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		BD1	[ RasMol ]	+environment [ RasMol ]
		BD2	[ RasMol ]	+environment [ RasMol ]
		BD3	[ RasMol ]	+environment [ RasMol ]
		BD4	[ RasMol ]	+environment [ RasMol ]
		BD5	[ RasMol ]	+environment [ RasMol ]
		BD6	[ RasMol ]	+environment [ RasMol ]
		BD7	[ RasMol ]	+environment [ RasMol ]
		BD8	[ RasMol ]	+environment [ RasMol ]
		BD9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]
		CC3	[ RasMol ]	+environment [ RasMol ]
		CC4	[ RasMol ]	+environment [ RasMol ]
		CC5	[ RasMol ]	+environment [ RasMol ]
		CC6	[ RasMol ]	+environment [ RasMol ]
		CC7	[ RasMol ]	+environment [ RasMol ]
		CC8	[ RasMol ]	+environment [ RasMol ]
		CC9	[ RasMol ]	+environment [ RasMol ]
		CD1	[ RasMol ]	+environment [ RasMol ]
		CD2	[ RasMol ]	+environment [ RasMol ]
		CD3	[ RasMol ]	+environment [ RasMol ]
		CD4	[ RasMol ]	+environment [ RasMol ]
		CD5	[ RasMol ]	+environment [ RasMol ]
		CD6	[ RasMol ]	+environment [ RasMol ]
		CD7	[ RasMol ]	+environment [ RasMol ]
		CD8	[ RasMol ]	+environment [ RasMol ]
		CD9	[ RasMol ]	+environment [ RasMol ]
		DC1	[ RasMol ]	+environment [ RasMol ]
		DC2	[ RasMol ]	+environment [ RasMol ]
		DC3	[ RasMol ]	+environment [ RasMol ]
		DC4	[ RasMol ]	+environment [ RasMol ]
		DC5	[ RasMol ]	+environment [ RasMol ]
		DC6	[ RasMol ]	+environment [ RasMol ]
		DC7	[ RasMol ]	+environment [ RasMol ]
		DC8	[ RasMol ]	+environment [ RasMol ]
		DC9	[ RasMol ]	+environment [ RasMol ]
		DD1	[ RasMol ]	+environment [ RasMol ]
		DD2	[ RasMol ]	+environment [ RasMol ]
		DD3	[ RasMol ]	+environment [ RasMol ]
		DD4	[ RasMol ]	+environment [ RasMol ]
		DD5	[ RasMol ]	+environment [ RasMol ]
		DD6	[ RasMol ]	+environment [ RasMol ]
		DD7	[ RasMol ]	+environment [ RasMol ]
		DD8	[ RasMol ]	+environment [ RasMol ]
		DD9	[ RasMol ]	+environment [ RasMol ]
		EC1	[ RasMol ]	+environment [ RasMol ]
		EC2	[ RasMol ]	+environment [ RasMol ]
		EC3	[ RasMol ]	+environment [ RasMol ]
		EC4	[ RasMol ]	+environment [ RasMol ]
		EC5	[ RasMol ]	+environment [ RasMol ]
		EC6	[ RasMol ]	+environment [ RasMol ]
		EC7	[ RasMol ]	+environment [ RasMol ]
		EC8	[ RasMol ]	+environment [ RasMol ]
		EC9	[ RasMol ]	+environment [ RasMol ]
		ED1	[ RasMol ]	+environment [ RasMol ]
		ED2	[ RasMol ]	+environment [ RasMol ]
		ED3	[ RasMol ]	+environment [ RasMol ]
		ED4	[ RasMol ]	+environment [ RasMol ]
		ED5	[ RasMol ]	+environment [ RasMol ]
		ED6	[ RasMol ]	+environment [ RasMol ]
		ED7	[ RasMol ]	+environment [ RasMol ]
		ED8	[ RasMol ]	+environment [ RasMol ]
		ED9	[ RasMol ]	+environment [ RasMol ]
		FC1	[ RasMol ]	+environment [ RasMol ]
		FC2	[ RasMol ]	+environment [ RasMol ]
		FC3	[ RasMol ]	+environment [ RasMol ]
		FC4	[ RasMol ]	+environment [ RasMol ]
		FC5	[ RasMol ]	+environment [ RasMol ]
		FC6	[ RasMol ]	+environment [ RasMol ]
		FC7	[ RasMol ]	+environment [ RasMol ]
		FC8	[ RasMol ]	+environment [ RasMol ]
		FC9	[ RasMol ]	+environment [ RasMol ]
		FD1	[ RasMol ]	+environment [ RasMol ]
		FD2	[ RasMol ]	+environment [ RasMol ]
		FD3	[ RasMol ]	+environment [ RasMol ]
		FD4	[ RasMol ]	+environment [ RasMol ]
		FD5	[ RasMol ]	+environment [ RasMol ]
		FD6	[ RasMol ]	+environment [ RasMol ]
		FD7	[ RasMol ]	+environment [ RasMol ]
		FD8	[ RasMol ]	+environment [ RasMol ]
		FD9	[ RasMol ]	+environment [ RasMol ]
		GC1	[ RasMol ]	+environment [ RasMol ]
		GC2	[ RasMol ]	+environment [ RasMol ]
		GC3	[ RasMol ]	+environment [ RasMol ]
		GC4	[ RasMol ]	+environment [ RasMol ]
		GC5	[ RasMol ]	+environment [ RasMol ]
		GC6	[ RasMol ]	+environment [ RasMol ]
		GC7	[ RasMol ]	+environment [ RasMol ]
		GC8	[ RasMol ]	+environment [ RasMol ]
		GC9	[ RasMol ]	+environment [ RasMol ]
		GD1	[ RasMol ]	+environment [ RasMol ]
		GD2	[ RasMol ]	+environment [ RasMol ]
		GD3	[ RasMol ]	+environment [ RasMol ]
		GD4	[ RasMol ]	+environment [ RasMol ]
		GD5	[ RasMol ]	+environment [ RasMol ]
		GD6	[ RasMol ]	+environment [ RasMol ]
		GD7	[ RasMol ]	+environment [ RasMol ]
		GD8	[ RasMol ]	+environment [ RasMol ]
		GD9	[ RasMol ]	+environment [ RasMol ]
		HC1	[ RasMol ]	+environment [ RasMol ]
		HC2	[ RasMol ]	+environment [ RasMol ]
		HC3	[ RasMol ]	+environment [ RasMol ]
		HC4	[ RasMol ]	+environment [ RasMol ]
		HC5	[ RasMol ]	+environment [ RasMol ]
		HC6	[ RasMol ]	+environment [ RasMol ]
		HC7	[ RasMol ]	+environment [ RasMol ]
		HC8	[ RasMol ]	+environment [ RasMol ]
		HC9	[ RasMol ]	+environment [ RasMol ]
		HD1	[ RasMol ]	+environment [ RasMol ]
		HD2	[ RasMol ]	+environment [ RasMol ]
		HD3	[ RasMol ]	+environment [ RasMol ]
		HD4	[ RasMol ]	+environment [ RasMol ]
		HD5	[ RasMol ]	+environment [ RasMol ]
		HD6	[ RasMol ]	+environment [ RasMol ]
		HD7	[ RasMol ]	+environment [ RasMol ]
		HD8	[ RasMol ]	+environment [ RasMol ]
		IC1	[ RasMol ]	+environment [ RasMol ]
		IC2	[ RasMol ]	+environment [ RasMol ]
		IC3	[ RasMol ]	+environment [ RasMol ]
		IC4	[ RasMol ]	+environment [ RasMol ]
		IC5	[ RasMol ]	+environment [ RasMol ]
		IC6	[ RasMol ]	+environment [ RasMol ]
		IC7	[ RasMol ]	+environment [ RasMol ]
		IC8	[ RasMol ]	+environment [ RasMol ]
		IC9	[ RasMol ]	+environment [ RasMol ]
		JC1	[ RasMol ]	+environment [ RasMol ]
		JC2	[ RasMol ]	+environment [ RasMol ]
		JC3	[ RasMol ]	+environment [ RasMol ]
		JC4	[ RasMol ]	+environment [ RasMol ]
		JC5	[ RasMol ]	+environment [ RasMol ]
		JC6	[ RasMol ]	+environment [ RasMol ]
		JC7	[ RasMol ]	+environment [ RasMol ]
		JC8	[ RasMol ]	+environment [ RasMol ]
		JC9	[ RasMol ]	+environment [ RasMol ]
		KC1	[ RasMol ]	+environment [ RasMol ]
		KC2	[ RasMol ]	+environment [ RasMol ]
		KC3	[ RasMol ]	+environment [ RasMol ]
		KC4	[ RasMol ]	+environment [ RasMol ]
		KC5	[ RasMol ]	+environment [ RasMol ]
		KC6	[ RasMol ]	+environment [ RasMol ]
		KC7	[ RasMol ]	+environment [ RasMol ]
		KC8	[ RasMol ]	+environment [ RasMol ]
		KC9	[ RasMol ]	+environment [ RasMol ]
		LC1	[ RasMol ]	+environment [ RasMol ]
		LC2	[ RasMol ]	+environment [ RasMol ]
		LC3	[ RasMol ]	+environment [ RasMol ]
		LC4	[ RasMol ]	+environment [ RasMol ]
		LC5	[ RasMol ]	+environment [ RasMol ]
		LC6	[ RasMol ]	+environment [ RasMol ]
		LC7	[ RasMol ]	+environment [ RasMol ]
		LC8	[ RasMol ]	+environment [ RasMol ]
		LC9	[ RasMol ]	+environment [ RasMol ]
		MC1	[ RasMol ]	+environment [ RasMol ]
		MC2	[ RasMol ]	+environment [ RasMol ]
		MC3	[ RasMol ]	+environment [ RasMol ]
		MC4	[ RasMol ]	+environment [ RasMol ]
		MC5	[ RasMol ]	+environment [ RasMol ]
		MC6	[ RasMol ]	+environment [ RasMol ]
		MC7	[ RasMol ]	+environment [ RasMol ]
		MC8	[ RasMol ]	+environment [ RasMol ]
		MC9	[ RasMol ]	+environment [ RasMol ]
		NC1	[ RasMol ]	+environment [ RasMol ]
		NC2	[ RasMol ]	+environment [ RasMol ]
		NC3	[ RasMol ]	+environment [ RasMol ]
		NC4	[ RasMol ]	+environment [ RasMol ]
		NC5	[ RasMol ]	+environment [ RasMol ]
		NC6	[ RasMol ]	+environment [ RasMol ]
		NC7	[ RasMol ]	+environment [ RasMol ]
		NC8	[ RasMol ]	+environment [ RasMol ]
		NC9	[ RasMol ]	+environment [ RasMol ]
		OC1	[ RasMol ]	+environment [ RasMol ]
		OC2	[ RasMol ]	+environment [ RasMol ]
		OC3	[ RasMol ]	+environment [ RasMol ]
		OC4	[ RasMol ]	+environment [ RasMol ]
		OC5	[ RasMol ]	+environment [ RasMol ]
		OC6	[ RasMol ]	+environment [ RasMol ]
		OC7	[ RasMol ]	+environment [ RasMol ]
		OC8	[ RasMol ]	+environment [ RasMol ]
		OC9	[ RasMol ]	+environment [ RasMol ]
		PC1	[ RasMol ]	+environment [ RasMol ]
		PC2	[ RasMol ]	+environment [ RasMol ]
		PC3	[ RasMol ]	+environment [ RasMol ]
		PC4	[ RasMol ]	+environment [ RasMol ]
		PC5	[ RasMol ]	+environment [ RasMol ]
		PC6	[ RasMol ]	+environment [ RasMol ]
		PC7	[ RasMol ]	+environment [ RasMol ]
		PC8	[ RasMol ]	+environment [ RasMol ]
		PC9	[ RasMol ]	+environment [ RasMol ]
		QC1	[ RasMol ]	+environment [ RasMol ]
		QC2	[ RasMol ]	+environment [ RasMol ]
		QC3	[ RasMol ]	+environment [ RasMol ]
		QC4	[ RasMol ]	+environment [ RasMol ]
		QC5	[ RasMol ]	+environment [ RasMol ]
		QC6	[ RasMol ]	+environment [ RasMol ]
		QC7	[ RasMol ]	+environment [ RasMol ]
		QC8	[ RasMol ]	+environment [ RasMol ]
		QC9	[ RasMol ]	+environment [ RasMol ]
		RC1	[ RasMol ]	+environment [ RasMol ]
		RC2	[ RasMol ]	+environment [ RasMol ]
		RC3	[ RasMol ]	+environment [ RasMol ]
		RC4	[ RasMol ]	+environment [ RasMol ]
		RC5	[ RasMol ]	+environment [ RasMol ]
		RC6	[ RasMol ]	+environment [ RasMol ]
		RC7	[ RasMol ]	+environment [ RasMol ]
		RC8	[ RasMol ]	+environment [ RasMol ]
		RC9	[ RasMol ]	+environment [ RasMol ]
		SC1	[ RasMol ]	+environment [ RasMol ]
		SC2	[ RasMol ]	+environment [ RasMol ]
		SC3	[ RasMol ]	+environment [ RasMol ]
		SC4	[ RasMol ]	+environment [ RasMol ]
		SC5	[ RasMol ]	+environment [ RasMol ]
		SC6	[ RasMol ]	+environment [ RasMol ]
		SC7	[ RasMol ]	+environment [ RasMol ]
		SC8	[ RasMol ]	+environment [ RasMol ]
		SC9	[ RasMol ]	+environment [ RasMol ]
		TC1	[ RasMol ]	+environment [ RasMol ]
		TC2	[ RasMol ]	+environment [ RasMol ]
		TC3	[ RasMol ]	+environment [ RasMol ]
		TC4	[ RasMol ]	+environment [ RasMol ]
		TC5	[ RasMol ]	+environment [ RasMol ]
		TC6	[ RasMol ]	+environment [ RasMol ]
		TC7	[ RasMol ]	+environment [ RasMol ]
		TC8	[ RasMol ]	+environment [ RasMol ]
		TC9	[ RasMol ]	+environment [ RasMol ]
		UC1	[ RasMol ]	+environment [ RasMol ]
		UC2	[ RasMol ]	+environment [ RasMol ]
		UC3	[ RasMol ]	+environment [ RasMol ]
		UC4	[ RasMol ]	+environment [ RasMol ]
		UC5	[ RasMol ]	+environment [ RasMol ]
		UC6	[ RasMol ]	+environment [ RasMol ]
		UC7	[ RasMol ]	+environment [ RasMol ]
		UC8	[ RasMol ]	+environment [ RasMol ]
		UC9	[ RasMol ]	+environment [ RasMol ]
		VC1	[ RasMol ]	+environment [ RasMol ]
		VC2	[ RasMol ]	+environment [ RasMol ]
		VC3	[ RasMol ]	+environment [ RasMol ]
		VC4	[ RasMol ]	+environment [ RasMol ]
		VC5	[ RasMol ]	+environment [ RasMol ]
		VC6	[ RasMol ]	+environment [ RasMol ]
		VC7	[ RasMol ]	+environment [ RasMol ]
		VC8	[ RasMol ]	+environment [ RasMol ]
		VC9	[ RasMol ]	+environment [ RasMol ]
		WC1	[ RasMol ]	+environment [ RasMol ]
		WC2	[ RasMol ]	+environment [ RasMol ]
		WC3	[ RasMol ]	+environment [ RasMol ]
		WC4	[ RasMol ]	+environment [ RasMol ]
		WC5	[ RasMol ]	+environment [ RasMol ]
		WC6	[ RasMol ]	+environment [ RasMol ]
		WC7	[ RasMol ]	+environment [ RasMol ]
		WC8	[ RasMol ]	+environment [ RasMol ]
		WC9	[ RasMol ]	+environment [ RasMol ]
		XC1	[ RasMol ]	+environment [ RasMol ]
		XC2	[ RasMol ]	+environment [ RasMol ]
		XC3	[ RasMol ]	+environment [ RasMol ]
		XC4	[ RasMol ]	+environment [ RasMol ]
		XC5	[ RasMol ]	+environment [ RasMol ]
		XC6	[ RasMol ]	+environment [ RasMol ]
		XC7	[ RasMol ]	+environment [ RasMol ]
		XC8	[ RasMol ]	+environment [ RasMol ]
		XC9	[ RasMol ]	+environment [ RasMol ]
		YC1	[ RasMol ]	+environment [ RasMol ]
		YC2	[ RasMol ]	+environment [ RasMol ]
		YC3	[ RasMol ]	+environment [ RasMol ]
		YC4	[ RasMol ]	+environment [ RasMol ]
		YC5	[ RasMol ]	+environment [ RasMol ]
		YC6	[ RasMol ]	+environment [ RasMol ]
		YC7	[ RasMol ]	+environment [ RasMol ]
		YC8	[ RasMol ]	+environment [ RasMol ]
		YC9	[ RasMol ]	+environment [ RasMol ]
		ZC1	[ RasMol ]	+environment [ RasMol ]
		ZC2	[ RasMol ]	+environment [ RasMol ]
		ZC3	[ RasMol ]	+environment [ RasMol ]
		ZC4	[ RasMol ]	+environment [ RasMol ]
		ZC5	[ RasMol ]	+environment [ RasMol ]
		ZC6	[ RasMol ]	+environment [ RasMol ]
		ZC7	[ RasMol ]	+environment [ RasMol ]
		ZC8	[ RasMol ]	+environment [ RasMol ]
		ZC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg M:184 - Pro M:185	[ RasMol ]
		Asn B:243 - Pro B:244	[ RasMol ]
		Gln F:55 - Pro F:56	[ RasMol ]
		Gly B:14 - Pro B:15	[ RasMol ]
		Trp A:186 - Pro A:187	[ RasMol ]
		Val C:136 - Pro C:137	[ RasMol ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (12, 311)

Sites (305, 305)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (26, 26)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (30, 31)

CATH Domains (32, 36)

Pfam Domains (26, 28)

Gene Ontology (23, 232)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File