Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CO-CRYSTAL STRUCTURE OF BRUCEANTIN BOUND TO THE LARGE RIBOSOMAL SUBUNIT
 
Authors :  G. Gurel, G. Blaha, P. B. Moore, T. A. Steitz
Date :  09 Feb 09  (Deposition) - 28 Apr 09  (Release) - 18 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.85
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,9
Keywords :  Large Ribosomal Subunit, Haloarcula Marismortui, Bruceantin, Ribonucleoprotein, Ribosomal Protein, Rna-Binding, Rrna-Binding, Trna-Binding, Metal-Binding, Zinc-Finger, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Gurel, G. Blaha, P. B. Moore, T. A. Steitz
U2504 Determines The Species Specificity Of The A-Site Clef Antibiotics: The Structures Of Tiamulin, Homoharringtonine, And Bruceantin Bound To The Ribosome.
J. Mol. Biol. V. 389 146 2009
PubMed-ID: 19362093  |  Reference-DOI: 10.1016/J.JMB.2009.04.005

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    FragmentRESIDUES 2634210-2637132
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 2 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    FragmentRESIDUES 143-264
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL2, HL4
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL3, HL1
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L4P
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL4, HL6
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL5, HL13
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL6, HL10
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHS6
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L10E
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymRIBOSOMAL PROTEIN L10, ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG, L10E, HMAL10
 
Molecule 9 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL11
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL13
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL14, HL27
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL15, HL9
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    Synonym50S RIBOSOMAL PROTEIN LC12
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL18, HL12
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL29, L19
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL19, HL24
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL31
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL22, HL23
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL23, HL25, L21
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL24, HL16, HL15
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL21/HL22
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL29, HL33
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHMAL30, HL20, HL16
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL34, HL30
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL5
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymL35E
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymHL39E, HL46E
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    SynonymLA, HLA
 
Molecule 31 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ01239

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (12, 311)

Asymmetric/Biological Unit (12, 311)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2CD5Ligand/IonCADMIUM ION
3CL22Ligand/IonCHLORIDE ION
4K2Ligand/IonPOTASSIUM ION
5MG93Ligand/IonMAGNESIUM ION
6NA75Ligand/IonSODIUM ION
7OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
8OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
9PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
10SR108Ligand/IonSTRONTIUM ION
11UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE
12WIN1Ligand/IonMETHYL (5BETA,7ALPHA,9BETA,10ALPHA,11ALPHA,12ALPHA,13BETA,15ALPHA)-15-{[(2E)-3,4-DIMETHYLPENT-2-ENOYL]OXY}-3,11,12-TRIHYDROXY-2,16-DIOXO-13,20-EPOXYPICRAS-3-EN-21-OATE

(-) Sites  (301, 301)

Asymmetric Unit (301, 301)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:3595 , HOH 0:7743 , HOH 0:8316BINDING SITE FOR RESIDUE MG 0 8001
002AC2SOFTWAREU 0:626 , G 0:627 , A 0:2483 , C 0:2534 , HOH 0:2977 , HOH 0:7721 , HOH 0:7722BINDING SITE FOR RESIDUE MG 0 8002
003AC3SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:6178 , HOH 0:8365 , ASN A:195 , HOH A:240BINDING SITE FOR RESIDUE MG 0 8003
004AC4SOFTWAREG 0:456 , A 0:459 , HOH 0:3102 , HOH 0:5983 , HOH 0:7728 , HOH 0:8488BINDING SITE FOR RESIDUE MG 0 8004
005AC5SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:7744 , HOH 0:7745 , HOH 0:8312BINDING SITE FOR RESIDUE MG 0 8005
006AC6SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:5129 , HOH 0:7737 , HOH 0:7827 , HOH 0:8329BINDING SITE FOR RESIDUE MG 0 8006
007AC7SOFTWAREG 0:2094 , U 0:2610 , G 0:2611 , A 0:2612 , HOH 0:7286 , HOH 0:7738 , HOH 0:7739 , HOH 0:8441BINDING SITE FOR RESIDUE MG 0 8007
008AC8SOFTWAREG 0:28 , U 0:1304 , HOH 0:3066 , HOH 0:5420 , HOH 0:7576 , HOH 0:7828 , HOH 0:8347BINDING SITE FOR RESIDUE MG 0 8008
009AC9SOFTWAREG 0:877 , G 0:2623 , A 0:2624 , HOH 0:6178 , HOH 0:7752 , HOH 0:8341 , HOH 0:8354BINDING SITE FOR RESIDUE MG 0 8009
010AD1SOFTWAREA 0:378 , G 0:379 , A 0:410 , A 0:429BINDING SITE FOR RESIDUE SR 0 8984
011AD2SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817BINDING SITE FOR RESIDUE SR 0 8985
012AD3SOFTWAREC 0:1102 , C 0:1103 , GLU J:28BINDING SITE FOR RESIDUE SR 0 8986
013AD4SOFTWAREG 0:2700BINDING SITE FOR RESIDUE SR 0 8988
014AD5SOFTWAREA 0:2622 , G 0:2623BINDING SITE FOR RESIDUE SR 0 8989
015AD6SOFTWAREG 0:2616 , G 0:2617 , G 0:2618BINDING SITE FOR RESIDUE SR 0 8990
016AD7SOFTWAREA 0:1427BINDING SITE FOR RESIDUE SR 0 8991
017AD8SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , MG 0:8089BINDING SITE FOR RESIDUE SR 0 8992
018AD9SOFTWAREC 0:847 , G 0:1694 , G 0:1695 , HOH 0:5638BINDING SITE FOR RESIDUE SR 0 8994
019BC1SOFTWAREG 0:2102 , C 0:2536 , G 0:2537 , HOH 0:3047 , HOH 0:7719 , HOH 0:8358 , HOH 0:9051BINDING SITE FOR RESIDUE MG 0 8010
020BC2SOFTWAREA 0:844 , A 0:882 , A 0:1689 , HOH 0:2943 , HOH 0:7754 , HOH 0:8322BINDING SITE FOR RESIDUE MG 0 8011
021BC3SOFTWAREG 0:456 , HOH 0:4595 , HOH 0:7729 , HOH 0:8719 , GLY C:86 , HOH C:2051 , HOH C:7228BINDING SITE FOR RESIDUE MG 0 8012
022BC4SOFTWAREA 0:2011 , HOH 0:7014 , HOH 0:7748 , HOH 0:7749 , HOH 0:7750 , HOH 0:9038BINDING SITE FOR RESIDUE MG 0 8013
023BC5SOFTWAREC 0:1830 , HOH 0:3377 , HOH 0:3388 , HOH 0:3700 , HOH 0:7732 , HOH 0:7751BINDING SITE FOR RESIDUE MG 0 8014
024BC6SOFTWAREG 0:2304 , HOH 0:6665 , HOH 0:7735 , HOH 0:7736 , HOH 0:8337 , HOH 0:8338BINDING SITE FOR RESIDUE MG 0 8015
025BC7SOFTWAREG 0:2097 , G 0:2540 , HOH 0:3340 , HOH 0:4719 , HOH 0:7740 , HOH 0:8644BINDING SITE FOR RESIDUE MG 0 8016
026BC8SOFTWAREA 0:1381 , HOH 0:6555 , HOH X:7830BINDING SITE FOR RESIDUE MG 0 8017
027BC9SOFTWAREU 0:1120 , G 0:1121 , HOH 0:7758 , HOH 0:7759 , HOH 0:7832 , NA 0:8502 , HOH 0:9057BINDING SITE FOR RESIDUE MG 0 8018
028BD1SOFTWAREG 0:2606 , G 0:2609BINDING SITE FOR RESIDUE SR 0 8995
029BD2SOFTWAREA 0:1411BINDING SITE FOR RESIDUE SR 0 8996
030BD3SOFTWAREA 0:791BINDING SITE FOR RESIDUE SR 0 8997
031BD4SOFTWAREG 0:834 , U 0:835BINDING SITE FOR RESIDUE SR 0 8998
032BD5SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9000
033BD6SOFTWAREC 0:2591BINDING SITE FOR RESIDUE SR 0 9001
034BD7SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9002
035BD8SOFTWAREG 0:2102 , A 0:2103BINDING SITE FOR RESIDUE SR 0 9004
036BD9SOFTWAREU 0:837 , HOH 0:3210BINDING SITE FOR RESIDUE SR 0 9007
037CC1SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:4522 , HOH 0:7760 , HOH 0:7761BINDING SITE FOR RESIDUE MG 0 8019
038CC2SOFTWAREC 0:240 , U 0:268 , G 0:269 , HOH 0:7833 , HOH 0:8647 , HOH 0:8794 , HOH 0:9043BINDING SITE FOR RESIDUE MG 0 8020
039CC3SOFTWAREA 0:1448 , U 0:1677 , HOH 0:8377 , HOH 0:8399 , HOH 0:8412 , THR S:54 , HOH S:7764BINDING SITE FOR RESIDUE MG 0 8021
040CC4SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:7747 , HOH 0:7765 , HOH 0:7766 , HOH 0:7767 , HOH 0:7768BINDING SITE FOR RESIDUE MG 0 8022
041CC5SOFTWAREU 0:1748 , U 0:1749 , HOH 0:5576 , HOH 0:7730 , HOH 0:7731 , HOH 0:7741 , HOH 0:8339BINDING SITE FOR RESIDUE MG 0 8023
042CC6SOFTWAREU 0:777 , C 0:778 , HOH 0:7867 , SR 0:8934 , HOH 1:7770BINDING SITE FOR RESIDUE MG 0 8024
043CC7SOFTWAREU 0:2115 , C 0:2273 , HOH 0:6755 , HOH 0:8427 , HOH 0:8494 , HOH 0:9078 , HOH A:7773BINDING SITE FOR RESIDUE MG 0 8025
044CC8SOFTWAREG 0:956 , HOH 0:4372 , HOH 0:7777 , HOH 0:7778 , HOH 0:7779 , HOH 0:8369BINDING SITE FOR RESIDUE MG 0 8026
045CC9SOFTWAREA 0:2553 , C 0:2575 , A 0:2576 , HOH 0:3196 , HOH 0:7285 , HOH 0:7542 , HOH 0:7837 , HOH 0:8348BINDING SITE FOR RESIDUE MG 0 8027
046CD1SOFTWAREU 0:1368 , HOH 0:3751 , HOH 0:7931 , HOH R:4997BINDING SITE FOR RESIDUE SR 0 9008
047CD2SOFTWAREA 0:2100 , G 0:2102 , A 0:2103 , G 0:2482 , A 0:2486 , C 0:2487 , A 0:2538 , U 0:2539 , G 0:2540 , HOH 0:3735 , HOH 0:3784 , HOH 0:8194 , K 0:8401BINDING SITE FOR RESIDUE WIN 0 9101
048CD3SOFTWAREG 0:1873 , HOH 0:3019 , ASP A:26 , LEU A:27 , ARG A:120BINDING SITE FOR RESIDUE MG A 8051
049CD4SOFTWARELYS A:178BINDING SITE FOR RESIDUE CL A 8809
050CD5SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208BINDING SITE FOR RESIDUE SR A 8929
051CD6SOFTWAREGLY A:116 , HOH A:2125BINDING SITE FOR RESIDUE SR A 8930
052CD7SOFTWAREHOH 0:5879 , HOH 0:7675 , HOH 0:8460 , HOH 0:8500 , GLY B:337 , HOH B:7791 , HOH B:7867BINDING SITE FOR RESIDUE MG B 8042
053CD8SOFTWAREHOH 0:5478 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 8819
054CD9SOFTWAREASN B:243 , SER B:245BINDING SITE FOR RESIDUE SR B 8950
055DC1SOFTWAREHOH 0:4033 , HOH 0:7781 , HOH 0:8325 , HOH 0:8349 , HOH 0:8370 , HOH 0:8372BINDING SITE FOR RESIDUE MG 0 8028
056DC2SOFTWAREU 0:115 , A 0:117 , G 0:118 , HOH 0:4061 , HOH 0:6468 , HOH 0:7782BINDING SITE FOR RESIDUE MG 0 8029
057DC3SOFTWAREU 0:392 , HOH 0:3429 , HOH 0:5627 , HOH 0:7839 , HOH 0:7840 , HOH 0:8495BINDING SITE FOR RESIDUE MG 0 8030
058DC4SOFTWAREC 0:195 , G 0:196 , A 0:227 , C 0:228 , HOH 0:8898 , HOH 0:9089 , HOH M:4431BINDING SITE FOR RESIDUE MG 0 8031
059DC5SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3118 , HOH 0:4673 , HOH 0:7784 , HOH 0:8357BINDING SITE FOR RESIDUE MG 0 8032
060DC6SOFTWAREG 0:816 , G 0:817 , HOH 0:6127 , HOH 0:7265 , HOH 0:7841BINDING SITE FOR RESIDUE MG 0 8033
061DC7SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:7907 , GLY R:65 , HOH R:7785BINDING SITE FOR RESIDUE MG 0 8034
062DC8SOFTWAREG 0:1979 , HOH 0:7786 , HOH 0:7842 , HOH 0:7843 , HOH 0:7844BINDING SITE FOR RESIDUE MG 0 8035
063DC9SOFTWAREG 0:1794 , HOH 0:7097 , HOH 0:7845 , HOH 0:7846BINDING SITE FOR RESIDUE MG 0 8036
064DD1SOFTWAREC 0:2672 , PHE B:26 , ARG B:310BINDING SITE FOR RESIDUE SR B 8987
065DD2SOFTWAREASP C:45 , THR C:94 , LYS C:96BINDING SITE FOR RESIDUE NA C 8503
066DD3SOFTWAREARG H:117BINDING SITE FOR RESIDUE NA H 8518
067DD4SOFTWAREA 0:2677 , HOH 0:4847 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69 , HOH J:4949BINDING SITE FOR RESIDUE NA J 8538
068DD5SOFTWAREASN J:126 , ILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 8801
069DD6SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 8802
070DD7SOFTWAREGLY J:64 , ASN J:65 , TYR J:69BINDING SITE FOR RESIDUE CL J 8821
071DD8SOFTWAREHOH 0:5362 , HOH 0:8120 , HOH 0:9130 , ASN K:42 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8054
072DD9SOFTWAREG 0:2582 , A 0:2596 , HOH 0:4058 , LYS K:14 , ILE K:32 , SER K:33 , PRO K:45BINDING SITE FOR RESIDUE CL K 8812
073EC1SOFTWAREA 0:1098 , HOH 0:5677 , HOH 0:7864BINDING SITE FOR RESIDUE MG 0 8037
074EC2SOFTWAREC 0:2248 , HOH 0:7128BINDING SITE FOR RESIDUE MG 0 8038
075EC3SOFTWAREG 0:641 , A 0:1355 , HOH 0:7787 , HOH 0:7788 , HOH 0:8893BINDING SITE FOR RESIDUE MG 0 8039
076EC4SOFTWAREC 0:162 , A 0:169 , U 0:2276 , HOH 0:4656 , HOH 0:7734 , HOH 0:7789 , HOH 0:7790BINDING SITE FOR RESIDUE MG 0 8041
077EC5SOFTWAREA 0:2719 , A 0:2757 , HOH 0:8367 , ASN B:335 , HOH B:1254 , HOH B:7811BINDING SITE FOR RESIDUE MG 0 8043
078EC6SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:3941 , MG 0:8045 , GLN A:207BINDING SITE FOR RESIDUE MG 0 8044
079EC7SOFTWAREG 0:2013 , HOH 0:7793 , HOH 0:7794 , MG 0:8044 , HOH 0:8469 , HOH A:7792 , HOH A:7868BINDING SITE FOR RESIDUE MG 0 8045
080EC8SOFTWAREG 0:2618 , HOH 0:3065 , HOH 0:3073 , HOH 0:7742 , HOH 0:8423BINDING SITE FOR RESIDUE MG 0 8046
081EC9SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:3573 , HOH 0:7795 , HOH 0:7796 , HOH 0:7797BINDING SITE FOR RESIDUE MG 0 8047
082ED1SOFTWAREARG L:53 , GLN L:58BINDING SITE FOR RESIDUE CL L 8810
083ED2SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:6250BINDING SITE FOR RESIDUE NA M 8539
084ED3SOFTWARESER M:106 , VAL M:114 , VAL M:159BINDING SITE FOR RESIDUE CL M 8818
085ED4SOFTWAREARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 8807
086ED5SOFTWAREHOH 0:5322 , HOH 0:5650 , HIS O:40BINDING SITE FOR RESIDUE CD O 8705
087ED6SOFTWAREHOH 0:6739 , ASN O:44 , ARG O:47BINDING SITE FOR RESIDUE CL O 8808
088ED7SOFTWAREASP Q:20 , ARG Q:21 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795BINDING SITE FOR RESIDUE NA Q 8540
089ED8SOFTWAREHOH 0:5181 , NA 0:8533 , SER R:70 , VAL R:72 , ASP R:73BINDING SITE FOR RESIDUE NA R 8532
090ED9SOFTWAREHOH 0:4257 , LYS R:118BINDING SITE FOR RESIDUE CL R 8806
091FC1SOFTWAREA 0:1369 , U 0:2650 , HOH 0:6153 , HOH 0:7798 , HOH 0:7799BINDING SITE FOR RESIDUE MG 0 8048
092FC2SOFTWAREHOH 0:6712 , HOH 0:7297 , HOH 0:7727 , HOH 0:7809 , HOH 0:9069BINDING SITE FOR RESIDUE MG 0 8049
093FC3SOFTWAREG 0:782 , C 0:783 , HOH A:396 , HOH A:2503 , HOH A:5306 , HOH A:7810BINDING SITE FOR RESIDUE MG 0 8050
094FC4SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:7802 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8052
095FC5SOFTWAREA 0:2568 , A 0:2569 , HOH 0:3676 , HOH 0:5607 , HOH 0:5814 , HOH 0:7870 , HOH 0:8453BINDING SITE FOR RESIDUE MG 0 8053
096FC6SOFTWAREA 0:166 , G 0:219 , HOH 0:3385 , HOH 0:3860 , HOH 0:4728 , HOH 0:8589BINDING SITE FOR RESIDUE MG 0 8055
097FC7SOFTWAREU 0:954 , C 0:2298 , HOH 0:7264 , HOH 0:7590 , HOH 0:8774 , HOH Q:7872BINDING SITE FOR RESIDUE MG 0 8056
098FC8SOFTWAREA 0:1286 , A 0:1287 , HOH 0:7803 , HOH W:7804 , HOH W:7873 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8058
099FC9SOFTWAREA 0:907 , A 0:908 , HOH 0:3832 , HOH 0:7805 , HOH 0:8336 , HOH 0:8691BINDING SITE FOR RESIDUE MG 0 8059
100FD1SOFTWARENA 0:8575 , GLN R:61 , ASN R:63BINDING SITE FOR RESIDUE SR R 8912
101FD2SOFTWAREHIS S:7 , GLU S:61 , HOH S:2519BINDING SITE FOR RESIDUE NA S 8510
102FD3SOFTWAREASP S:59BINDING SITE FOR RESIDUE SR S 8961
103FD4SOFTWARETYR T:35 , GLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8057
104FD5SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 8701
105FD6SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:3892 , HOH Y:5308BINDING SITE FOR RESIDUE MG Y 8086
106FD7SOFTWAREG 0:1269 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 8820
107FD8SOFTWARECYS Z:63 , CYS Z:66 , CYS Z:81 , CYS Z:84BINDING SITE FOR RESIDUE CD Z 8703
108FD9SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 8702
109GC1SOFTWAREG 0:164 , A 0:165 , A 0:167 , C 0:168 , HOH 0:8311 , HOH 0:8317 , HOH 0:8328 , NA 0:8513BINDING SITE FOR RESIDUE MG 0 8061
110GC2SOFTWAREA 0:1684 , U 0:1724 , HOH 0:3225 , HOH 0:6254 , HOH 0:7816 , HOH 0:7880 , HOH 0:9094BINDING SITE FOR RESIDUE MG 0 8062
111GC3SOFTWAREA 0:1437 , HOH 0:4137 , HOH 0:4252 , HOH 0:7889 , HOH P:7890BINDING SITE FOR RESIDUE MG 0 8063
112GC4SOFTWAREC 0:1753 , A 0:1754 , HOH 0:5792 , HOH 0:7817 , HOH 0:7881 , HOH 0:8409 , HOH 0:9039BINDING SITE FOR RESIDUE MG 0 8064
113GC5SOFTWAREA 0:1742 , G 0:1743 , G 0:1745 , HOH 0:3903 , HOH 0:4402 , HOH 0:5888 , HOH 0:7818 , HOH 0:8334BINDING SITE FOR RESIDUE MG 0 8065
114GC6SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3028 , HOH 0:3065 , HOH 0:3214 , HOH 0:5293BINDING SITE FOR RESIDUE MG 0 8066
115GC7SOFTWAREG 0:2540 , G 0:2611 , G 0:2646 , HOH 0:2939 , HOH 0:3146 , HOH 0:4077 , HOH 0:6978 , NA 0:8534BINDING SITE FOR RESIDUE MG 0 8067
116GC8SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:7821 , HOH 0:7882 , HOH 0:7883BINDING SITE FOR RESIDUE MG 0 8068
117GC9SOFTWAREA 0:2103 , A 0:2479 , HOH 0:5142 , HOH 0:8315 , HOH 0:8518BINDING SITE FOR RESIDUE MG 0 8069
118GD1SOFTWAREHOH 0:5981 , ASP 1:47BINDING SITE FOR RESIDUE SR 1 8952
119GD2SOFTWAREHOH 0:6489 , HOH 0:7876 , HOH 0:7877BINDING SITE FOR RESIDUE MG 2 8060
120GD3SOFTWARECYS 3:11 , CYS 3:14 , GLN 3:18 , CYS 3:71 , CYS 3:74BINDING SITE FOR RESIDUE CD 3 8704
121GD4SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 8804
122GD5SOFTWAREHOH 0:8734 , GLY 3:45 , GLY 3:47 , ASP 3:49BINDING SITE FOR RESIDUE SR 3 8932
123GD6SOFTWAREASP 3:59BINDING SITE FOR RESIDUE SR 3 8999
124GD7SOFTWAREU 0:1125 , HOH 0:7866 , G 9:90 , HOH 9:737 , HOH 9:2054BINDING SITE FOR RESIDUE MG 9 8040
125GD8SOFTWAREG 9:21 , A 9:56 , HOH 9:7361BINDING SITE FOR RESIDUE MG 9 8074
126GD9SOFTWAREC 9:40BINDING SITE FOR RESIDUE NA 9 8543
127HC1SOFTWAREG 0:918 , HOH 0:3245 , HOH 0:5086 , HOH 0:5968 , HOH 0:7822 , HOH 0:7934BINDING SITE FOR RESIDUE MG 0 8070
128HC2SOFTWAREA 0:1843 , C 0:1844 , HOH 0:4483 , HOH 0:7884 , HOH 0:8344 , HOH 0:8359BINDING SITE FOR RESIDUE MG 0 8071
129HC3SOFTWAREA 0:914 , A 0:1070 , G 0:1071 , HOH 0:5597 , HOH 0:8350 , HOH 0:8381 , HOH 0:8424BINDING SITE FOR RESIDUE MG 0 8072
130HC4SOFTWAREU 0:1096 , C 0:1257 , G 0:1258 , HOH 0:7823 , HOH 0:7885BINDING SITE FOR RESIDUE MG 0 8073
131HC5SOFTWAREG 0:1848 , G 0:1849 , HOH 0:8362 , HOH 0:8400 , HOH 0:8607 , HOH 0:8639BINDING SITE FOR RESIDUE MG 0 8075
132HC6SOFTWAREG 0:863 , U 0:864 , HOH 0:4669 , HOH 0:7952 , HOH 0:8371 , HOH 0:8375BINDING SITE FOR RESIDUE MG 0 8076
133HC7SOFTWAREA 0:907 , HOH 0:6583 , HOH 0:7981 , HOH 0:8383 , HOH 0:8449 , HOH Y:4368BINDING SITE FOR RESIDUE MG 0 8077
134HC8SOFTWAREA 0:2612 , HOH 0:6836 , HOH 0:8366 , HOH 0:8378BINDING SITE FOR RESIDUE MG 0 8078
135HC9SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:3402 , HOH 0:8448BINDING SITE FOR RESIDUE MG 0 8079
136HD1SOFTWAREG 9:21 , G 9:22 , U 9:55 , A 9:57 , G 9:58 , HOH 9:7361BINDING SITE FOR RESIDUE NA 9 8572
137HD2SOFTWAREC 0:1129 , HOH 0:3843 , HOH 0:7866 , C 9:91 , G 9:92 , HOH 9:2054BINDING SITE FOR RESIDUE SR 9 8978
138HD3SOFTWAREG 9:78 , G 9:102BINDING SITE FOR RESIDUE SR 9 8980
139HD4SOFTWAREG 9:32 , A 9:44BINDING SITE FOR RESIDUE SR 9 9003
140IC1SOFTWAREA 0:2433 , A 0:2434 , U 0:2458 , HOH 0:3917 , HOH 0:6399 , HOH 0:7897BINDING SITE FOR RESIDUE MG 0 8080
141IC2SOFTWAREG 0:2578 , G 0:2579 , HOH 0:7886BINDING SITE FOR RESIDUE MG 0 8081
142IC3SOFTWAREC 0:2104 , C 0:2105 , HOH 0:7724BINDING SITE FOR RESIDUE MG 0 8082
143IC4SOFTWAREG 0:795 , G 0:817 , HOH 0:7841 , HOH 0:8300 , HOH P:5319 , HOH P:7259BINDING SITE FOR RESIDUE MG 0 8083
144IC5SOFTWAREC 0:1103 , A 0:1106 , A 0:1107 , HOH 0:7850 , HOH 0:7851 , HOH 0:7852 , HOH 0:7853BINDING SITE FOR RESIDUE MG 0 8084
145IC6SOFTWAREHOH 0:5433 , HOH 0:7369 , HOH 0:7858 , HOH 0:7859 , HOH 0:7860BINDING SITE FOR RESIDUE MG 0 8085
146IC7SOFTWAREU 0:903 , A 0:1357 , HOH 0:4458 , HOH 0:4963 , HOH 0:5344 , HOH 0:8701BINDING SITE FOR RESIDUE MG 0 8087
147IC8SOFTWAREA 0:187 , HOH 0:3416 , HOH 0:4237 , HOH 0:5170 , HOH 0:8429 , HOH 0:8473BINDING SITE FOR RESIDUE MG 0 8088
148IC9SOFTWAREA 0:2112 , HOH 0:3770 , HOH 0:5249 , HOH 0:5474 , HOH 0:5848 , HOH 0:8699 , SR 0:8992BINDING SITE FOR RESIDUE MG 0 8089
149JC1SOFTWAREA 0:2430 , HOH 0:3672 , HOH 0:4707 , HOH 0:8368 , HOH 0:8742BINDING SITE FOR RESIDUE MG 0 8090
150JC2SOFTWAREHOH 0:2928 , HOH 0:2950 , HOH 0:5843 , HOH 0:6129 , HOH 0:7887 , MG 0:8092 , HOH A:4097BINDING SITE FOR RESIDUE MG 0 8091
151JC3SOFTWAREU 0:1850 , HOH 0:5649 , MG 0:8091 , HOH 0:8362 , HOH 0:8388 , HOH 0:8639BINDING SITE FOR RESIDUE MG 0 8092
152JC4SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:3418 , HOH 0:3797 , HOH 0:6075BINDING SITE FOR RESIDUE MG 0 8093
153JC5SOFTWAREG 0:2102 , G 0:2482 , U 0:2535 , C 0:2536 , U 0:2539 , WIN 0:9101BINDING SITE FOR RESIDUE K 0 8401
154JC6SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:2991BINDING SITE FOR RESIDUE K 0 8402
155JC7SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:7404BINDING SITE FOR RESIDUE NA 0 8501
156JC8SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , MG 0:8018BINDING SITE FOR RESIDUE NA 0 8502
157JC9SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:3514 , HOH 0:4986 , HOH 0:8878BINDING SITE FOR RESIDUE NA 0 8504
158KC1SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649BINDING SITE FOR RESIDUE NA 0 8505
159KC2SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 8506
160KC3SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:8110 , SR 0:8962BINDING SITE FOR RESIDUE NA 0 8507
161KC4SOFTWAREA 0:2577 , G 0:2578 , G 0:2579BINDING SITE FOR RESIDUE NA 0 8508
162KC5SOFTWAREU 0:2523 , G 0:2524 , G 0:2525 , HOH 0:8274BINDING SITE FOR RESIDUE NA 0 8509
163KC6SOFTWAREU 0:2389 , G 0:2399 , HOH 0:4019 , HOH 0:4089 , HOH 0:6616 , HOH 0:8608BINDING SITE FOR RESIDUE NA 0 8511
164KC7SOFTWAREU 0:2541 , U 0:2607 , C 0:2608 , HOH 0:4242 , HOH 0:4857 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8512
165KC8SOFTWAREA 0:165 , A 0:166 , A 0:167 , MG 0:8061BINDING SITE FOR RESIDUE NA 0 8513
166KC9SOFTWAREC 0:896 , A 0:897 , HOH 0:3036 , HOH 0:5600 , HOH 0:5736 , HOH 0:7642BINDING SITE FOR RESIDUE NA 0 8514
167LC1SOFTWAREG 0:1416 , G 0:1417 , HOH 0:4003 , HOH 0:4135 , TRP 2:42 , ASN 2:45 , ASP 2:46BINDING SITE FOR RESIDUE NA 0 8515
168LC2SOFTWAREG 0:2543 , G 0:2544 , HOH 0:8162 , NA 0:8517 , HOH 0:8705BINDING SITE FOR RESIDUE NA 0 8516
169LC3SOFTWAREG 0:2543 , G 0:2611 , U 0:2615 , HOH 0:3129 , HOH 0:3236 , HOH 0:5861 , NA 0:8516BINDING SITE FOR RESIDUE NA 0 8517
170LC4SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:3208BINDING SITE FOR RESIDUE NA 0 8519
171LC5SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:4895BINDING SITE FOR RESIDUE NA 0 8520
172LC6SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:5371 , HOH 0:7610 , HOH 0:7867 , SR 0:8934BINDING SITE FOR RESIDUE NA 0 8521
173LC7SOFTWAREG 0:1971 , G 0:2009 , U 0:2012BINDING SITE FOR RESIDUE NA 0 8522
174LC8SOFTWAREU 0:821 , C 0:822 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:5779 , HOH 0:7527BINDING SITE FOR RESIDUE NA 0 8523
175LC9SOFTWAREG 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5962BINDING SITE FOR RESIDUE NA 0 8524
176MC1SOFTWAREG 0:66 , U 0:107 , U 0:108BINDING SITE FOR RESIDUE NA 0 8525
177MC2SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:3855BINDING SITE FOR RESIDUE NA 0 8526
178MC3SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221BINDING SITE FOR RESIDUE NA 0 8527
179MC4SOFTWAREG 0:386 , G 0:387 , G 0:388 , U 0:402BINDING SITE FOR RESIDUE NA 0 8528
180MC5SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:4260BINDING SITE FOR RESIDUE NA 0 8529
181MC6SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:6315BINDING SITE FOR RESIDUE NA 0 8530
182MC7SOFTWAREG 0:1706 , G 0:1707 , HOH 0:4383 , HOH 0:6511 , HOH 0:7172 , HOH 0:7645BINDING SITE FOR RESIDUE NA 0 8531
183MC8SOFTWAREU 0:2659 , G 0:2660 , HOH 0:8463 , SER R:70 , VAL R:72 , TRP R:75 , HOH R:1316 , NA R:8532BINDING SITE FOR RESIDUE NA 0 8533
184MC9SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , MG 0:8067BINDING SITE FOR RESIDUE NA 0 8534
185NC1SOFTWAREU 0:1740 , U 0:1741 , G 0:2033BINDING SITE FOR RESIDUE NA 0 8535
186NC2SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:7891BINDING SITE FOR RESIDUE NA 0 8536
187NC3SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , HOH 0:6368 , SER T:94 , ASN T:95BINDING SITE FOR RESIDUE NA 0 8537
188NC4SOFTWAREA 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045 , HOH 0:4725BINDING SITE FOR RESIDUE NA 0 8541
189NC5SOFTWAREU 0:623 , U 0:624 , C 0:633 , G 0:901 , HOH 0:6642BINDING SITE FOR RESIDUE NA 0 8542
190NC6SOFTWAREA 0:955 , C 9:81 , U 9:82BINDING SITE FOR RESIDUE NA 0 8544
191NC7SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:3673BINDING SITE FOR RESIDUE NA 0 8545
192NC8SOFTWAREG 0:1119 , C 0:1243 , HOH 0:3661 , HOH 0:6359 , THR J:47BINDING SITE FOR RESIDUE NA 0 8546
193NC9SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:4714BINDING SITE FOR RESIDUE NA 0 8547
194OC1SOFTWAREG 0:941 , U 0:942 , G 0:1024BINDING SITE FOR RESIDUE NA 0 8548
195OC2SOFTWAREU 0:2610 , G 0:2611 , HOH 0:4857 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8549
196OC3SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 8550
197OC4SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5232BINDING SITE FOR RESIDUE NA 0 8551
198OC5SOFTWAREU 0:837 , HOH 0:3356 , HOH 0:3791 , GLN B:230BINDING SITE FOR RESIDUE NA 0 8552
199OC6SOFTWAREG 0:2110 , G 0:2111 , U 0:2277 , HOH 0:3140 , HOH 0:4339BINDING SITE FOR RESIDUE NA 0 8553
200OC7SOFTWAREU 0:1359 , C 0:1360 , HOH 0:8174 , GLY C:66BINDING SITE FOR RESIDUE NA 0 8554
201OC8SOFTWAREG 0:636 , U 0:2057 , G 0:2058 , HOH 0:6139BINDING SITE FOR RESIDUE NA 0 8555
202OC9SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 0 8556
203PC1SOFTWAREG 0:544 , G 0:545 , U 0:611 , U 0:612 , HOH 0:8655BINDING SITE FOR RESIDUE NA 0 8557
204PC2SOFTWAREG 0:464 , G 0:475 , HOH 0:3207 , HOH 0:6187 , ARG C:55BINDING SITE FOR RESIDUE NA 0 8558
205PC3SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 0 8559
206PC4SOFTWAREU 0:392 , A 0:395BINDING SITE FOR RESIDUE NA 0 8560
207PC5SOFTWAREG 0:1832 , A 0:2022 , HOH 0:3314BINDING SITE FOR RESIDUE NA 0 8561
208PC6SOFTWAREU 0:2492 , G 0:2529BINDING SITE FOR RESIDUE NA 0 8562
209PC7SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924 , HOH 0:3978BINDING SITE FOR RESIDUE NA 0 8563
210PC8SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , HOH 0:7101BINDING SITE FOR RESIDUE NA 0 8564
211PC9SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 0 8565
212QC1SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:3944BINDING SITE FOR RESIDUE NA 0 8566
213QC2SOFTWAREG 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:5777BINDING SITE FOR RESIDUE NA 0 8567
214QC3SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:7539 , HIS L:18 , HOH L:2203 , HOH L:4311BINDING SITE FOR RESIDUE NA 0 8568
215QC4SOFTWAREU 0:831 , U 0:832 , G 0:833 , C 0:849 , HOH 0:8415BINDING SITE FOR RESIDUE NA 0 8569
216QC5SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4236 , HOH 0:6803 , HOH 0:8390BINDING SITE FOR RESIDUE NA 0 8570
217QC6SOFTWAREG 0:2772 , G 0:2773BINDING SITE FOR RESIDUE NA 0 8571
218QC7SOFTWAREC 0:197 , HOH 0:4264BINDING SITE FOR RESIDUE NA 0 8573
219QC8SOFTWAREG 0:1077 , A 0:1079 , HOH 0:7635BINDING SITE FOR RESIDUE NA 0 8574
220QC9SOFTWAREU 0:12 , C 0:2086 , C 0:2087 , ASN R:63 , SR R:8912BINDING SITE FOR RESIDUE NA 0 8575
221RC1SOFTWAREG 0:1452 , G 0:1676 , LYS 2:2BINDING SITE FOR RESIDUE CL 0 8803
222RC2SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 0 8805
223RC3SOFTWAREC 0:2388 , PHE Q:52 , HIS Q:53BINDING SITE FOR RESIDUE CL 0 8811
224RC4SOFTWAREG 0:1299 , A 0:1328 , G 0:1329 , HOH 0:3448 , HOH 0:3850BINDING SITE FOR RESIDUE CL 0 8813
225RC5SOFTWAREG 0:644 , HOH 0:7681 , HIS L:13BINDING SITE FOR RESIDUE CL 0 8814
226RC6SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 8815
227RC7SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 8816
228RC8SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:3456BINDING SITE FOR RESIDUE CL 0 8817
229RC9SOFTWAREG 0:1072 , G 0:1087BINDING SITE FOR RESIDUE CL 0 8822
230SC1SOFTWAREU 0:823 , G 0:824 , G 0:854 , HOH 0:2936 , HOH 0:3123 , HOH 0:3276 , HOH 0:8735BINDING SITE FOR RESIDUE SR 0 8901
231SC2SOFTWAREG 0:836 , U 0:2615 , HOH 0:3971 , HOH 0:4360 , GLN B:230BINDING SITE FOR RESIDUE SR 0 8902
232SC3SOFTWAREG 0:1489 , G 0:1491 , HOH 0:4538BINDING SITE FOR RESIDUE SR 0 8903
233SC4SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:4646BINDING SITE FOR RESIDUE SR 0 8904
234SC5SOFTWAREA 0:1754 , A 0:1755 , HOH 0:6927 , HOH 0:7509BINDING SITE FOR RESIDUE SR 0 8905
235SC6SOFTWAREC 0:893 , HOH C:1644BINDING SITE FOR RESIDUE SR 0 8906
236SC7SOFTWAREG 0:1055 , HOH 0:3682 , HOH 0:8600 , ASP H:13 , HOH H:2609BINDING SITE FOR RESIDUE SR 0 8907
237SC8SOFTWAREU 0:146 , G 0:147 , A 0:183 , ASP M:157 , HOH M:2150BINDING SITE FOR RESIDUE SR 0 8908
238SC9SOFTWAREHOH 0:4603 , HOH 0:7824BINDING SITE FOR RESIDUE SR 0 8909
239TC1SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585BINDING SITE FOR RESIDUE SR 0 8910
240TC2SOFTWAREC 0:85 , A 0:86 , C 0:87 , ASP T:68BINDING SITE FOR RESIDUE SR 0 8911
241TC3SOFTWAREC 0:778 , U 0:862 , HOH 1:211BINDING SITE FOR RESIDUE SR 0 8913
242TC4SOFTWAREHOH 0:4220BINDING SITE FOR RESIDUE SR 0 8914
243TC5SOFTWAREU 0:664 , G 0:681 , HOH C:1269BINDING SITE FOR RESIDUE SR 0 8915
244TC6SOFTWAREC 0:1420 , C 0:1421 , G 0:1438BINDING SITE FOR RESIDUE SR 0 8916
245TC7SOFTWAREC 0:478 , HOH 0:8716BINDING SITE FOR RESIDUE SR 0 8917
246TC8SOFTWAREA 0:1504 , A 0:1678 , C 0:1679BINDING SITE FOR RESIDUE SR 0 8918
247TC9SOFTWAREG 0:2632 , HOH 0:5766BINDING SITE FOR RESIDUE SR 0 8920
248UC1SOFTWAREA 0:1717 , G 0:1718 , HOH 0:8755BINDING SITE FOR RESIDUE SR 0 8921
249UC2SOFTWAREG 0:471BINDING SITE FOR RESIDUE SR 0 8922
250UC3SOFTWAREG 0:1059 , C 0:1127 , HOH 0:8428BINDING SITE FOR RESIDUE SR 0 8923
251UC4SOFTWAREG 0:2725 , G 0:2755BINDING SITE FOR RESIDUE SR 0 8924
252UC5SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 8925
253UC6SOFTWAREHOH 0:7953BINDING SITE FOR RESIDUE SR 0 8926
254UC7SOFTWAREA 0:2553BINDING SITE FOR RESIDUE SR 0 8927
255UC8SOFTWAREG 0:1110 , A 0:1247BINDING SITE FOR RESIDUE SR 0 8928
256UC9SOFTWAREG 0:1543BINDING SITE FOR RESIDUE SR 0 8931
257VC1SOFTWAREA 0:532 , U 0:533 , HOH 0:7820BINDING SITE FOR RESIDUE SR 0 8933
258VC2SOFTWAREU 0:777 , U 0:864 , MG 0:8024 , NA 0:8521BINDING SITE FOR RESIDUE SR 0 8934
259VC3SOFTWAREG 0:2421 , U 0:2422 , C 0:2423BINDING SITE FOR RESIDUE SR 0 8935
260VC4SOFTWAREA 0:1291 , G 0:1292 , HOH 0:8314BINDING SITE FOR RESIDUE SR 0 8936
261VC5SOFTWAREHOH 0:2940BINDING SITE FOR RESIDUE SR 0 8937
262VC6SOFTWAREU 0:2445BINDING SITE FOR RESIDUE SR 0 8938
263VC7SOFTWAREG 0:84 , C 0:85 , ASP T:68BINDING SITE FOR RESIDUE SR 0 8939
264VC8SOFTWAREA 0:2465 , G 0:2466 , HOH 0:5364 , ASP L:36BINDING SITE FOR RESIDUE SR 0 8940
265VC9SOFTWAREG 0:1683 , U 0:1696BINDING SITE FOR RESIDUE SR 0 8941
266WC1SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:5120 , HOH 0:7896BINDING SITE FOR RESIDUE SR 0 8942
267WC2SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6101BINDING SITE FOR RESIDUE SR 0 8943
268WC3SOFTWAREU 0:2016BINDING SITE FOR RESIDUE SR 0 8944
269WC4SOFTWAREG 0:1484 , HOH 0:7835BINDING SITE FOR RESIDUE SR 0 8945
270WC5SOFTWAREG 0:2091BINDING SITE FOR RESIDUE SR 0 8946
271WC6SOFTWAREC 0:1687 , C 0:1690 , ARG 2:43BINDING SITE FOR RESIDUE SR 0 8947
272WC7SOFTWAREA 0:2302 , A 0:2303 , HOH 0:8342BINDING SITE FOR RESIDUE SR 0 8948
273WC8SOFTWAREU 0:821 , C 0:822 , G 0:854 , U 0:855 , G 0:856 , HOH 0:6109 , HOH 0:8318BINDING SITE FOR RESIDUE SR 0 8949
274WC9SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 8951
275XC1SOFTWAREU 0:391 , ARG 3:42BINDING SITE FOR RESIDUE SR 0 8953
276XC2SOFTWAREG 0:2810 , HOH 0:7518BINDING SITE FOR RESIDUE SR 0 8954
277XC3SOFTWAREU 0:2557BINDING SITE FOR RESIDUE SR 0 8955
278XC4SOFTWAREA 0:682 , G 0:683BINDING SITE FOR RESIDUE SR 0 8956
279XC5SOFTWAREU 0:1463 , C 0:1474 , GLY 1:40BINDING SITE FOR RESIDUE SR 0 8957
280XC6SOFTWAREA 0:1133 , G 0:1134BINDING SITE FOR RESIDUE SR 0 8958
281XC7SOFTWAREU 0:1972BINDING SITE FOR RESIDUE SR 0 8959
282XC8SOFTWAREG 0:1113 , HOH 0:8394BINDING SITE FOR RESIDUE SR 0 8960
283XC9SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , NA 0:8507BINDING SITE FOR RESIDUE SR 0 8962
284YC1SOFTWAREG 0:2284BINDING SITE FOR RESIDUE SR 0 8963
285YC2SOFTWAREG 0:2777BINDING SITE FOR RESIDUE SR 0 8964
286YC3SOFTWAREHOH 0:7807BINDING SITE FOR RESIDUE SR 0 8965
287YC4SOFTWAREC 0:235 , HOH 0:3515 , HOH 0:7464BINDING SITE FOR RESIDUE SR 0 8966
288YC5SOFTWAREU 0:2690BINDING SITE FOR RESIDUE SR 0 8967
289YC6SOFTWAREG 0:2522 , C 9:91BINDING SITE FOR RESIDUE SR 0 8968
290YC7SOFTWAREA 0:1040 , A 0:1296 , GLY L:14BINDING SITE FOR RESIDUE SR 0 8969
291YC8SOFTWAREA 0:565 , G 0:592BINDING SITE FOR RESIDUE SR 0 8970
292YC9SOFTWAREA 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , PRO H:162BINDING SITE FOR RESIDUE SR 0 8972
293ZC1SOFTWAREHOH 0:5928BINDING SITE FOR RESIDUE SR 0 8973
294ZC2SOFTWAREU 0:1835BINDING SITE FOR RESIDUE SR 0 8974
295ZC3SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE SR 0 8975
296ZC4SOFTWAREG 0:1726BINDING SITE FOR RESIDUE SR 0 8976
297ZC5SOFTWAREG 0:2249 , GLU A:28BINDING SITE FOR RESIDUE SR 0 8977
298ZC6SOFTWAREG 0:2639BINDING SITE FOR RESIDUE SR 0 8979
299ZC7SOFTWAREG 0:1290 , A 0:1291 , HOH 0:3869BINDING SITE FOR RESIDUE SR 0 8981
300ZC8SOFTWAREA 0:1746 , A 0:1747 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 0 8982
301ZC9SOFTWAREG 0:911 , HOH 0:9155BINDING SITE FOR RESIDUE SR 0 8983

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3G71)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 3G71)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                3g71 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains 3g71100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh.......ee.........ee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                3g71 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains ------------------------------------------------- SCOP domains
               CATH domains 3g71200 2:1-49                                    CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh....hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                3g71 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                3g71 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                3g71 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeeee.........eee...........eee........eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhh...................ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71B01 B:1-38,B:207-257              3g71B02 B:39-77,B:189-206,B:258-337    3g71B03 B:78-188  [code=3.30.1430.10, no name defined]                                                         3g71B02           3g71B01 B:1-38,B:207-257                           3g71B02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeee.......hhhhh.......hhhhhhhhhhhhhhh..eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhh...eehhhhhh....eeeeeee.....eehhhhhhh....hhhhhhh........................ee....eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3g71C00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee..............eeee....hhhhhhhhhh....eeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3g71 C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71D00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----hhhhhhhhhhh....eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee...hhhhhh.............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71E01 E:1-79  [code=3.90.930.12, no name defined]                            3g71E02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee.....eeeeee..eeeeee...hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71F00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhh.....eeee..........hhhhhhhh....eeee.hhhhhhhhh.......eeee.....hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3g71 G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71H00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh................................hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhhhhh...eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains 3g71I00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh................eehhhhhhhhhhhh.......hhhhhhhhhhhhhh....ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                3g71 I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71J00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3g71K00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee..............eehhhhhhhhhhhh....ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3g71 K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3g71L01 L:1-50                                    3g71L02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhh.....................................................eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhh...eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3g71 L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71M00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.....hhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhh.......hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 M    1 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3g71N00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhh......eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhh...................hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3g71 N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71O00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhheeehhhhhhhhh....eeeeeeee..........eeeeeeehhhhhhhhhhh.eeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71P01 P:1-55  [code=1.10.1650.10, no name defined]   3g71P02 P:56-88 Single Heli x bin3g71P03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhh..hhhhhhhhhhh..eee.......hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71Q00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhh....hhhhhh......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                3g71 Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3g71R00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........hhh.eeeeeeeeee.hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeeee..eee.....eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3g71 R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains --------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71S00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                3g71 S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71T00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains 3g71U00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                3g71 U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains 3g71V00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                3g71 V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71W01 W:1-57,W:114-154                                 3g71W02 W:58-113  [code=1.10.15.30, no name defined]    3g71W01 W:1-57,W:114-154                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eee...hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.....................ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71X00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhh.hhhhhhhhhhhhhhhhhhhhh......eeehhhhhhhhh.........eeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3g71 X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhh.......eeeee....hhhhhhhhhhhhhh.........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3g71 Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains ------------------------------------------------------------------------- SCOP domains
               CATH domains 3g71Z00 Z:34-106  [code=2.20.25.30, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...hhhhhhhhhhhhh...............eee....eeee.....eee................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                3g71 Z   34 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS  106
                                    43        53        63        73        83        93       103   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3G71)

(-) CATH Domains  (30, 33)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3G71)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    WIN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]