Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ERYTHROMYCIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Date :  11 Jan 05  (Deposition) - 26 Apr 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,9
Keywords :  Erythromycin, Antibiotic Complexes, Mutated 50S Subunits, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Structures Of Mlsbk Antibiotics Bound To Mutated Large Ribosomal Subunits Provide A Structural Explanation For Resistance.
Cell(Cambridge, Mass. ) V. 121 257 2005
PubMed-ID: 15851032  |  Reference-DOI: 10.1016/J.CELL.2005.02.005

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains0
    MutationYES
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    Other DetailsENCODED BY RRNA OPERON
    StrainDT38
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains9
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L2P
    ChainsA
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L3P
    ChainsB
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L4E
    ChainsC
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L5P
    ChainsD
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L6P
    ChainsE
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L7AE
    ChainsF
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 9 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    ChainsG
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L10E
    ChainsH
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L11P
    ChainsI
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L13P
    ChainsJ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L14P
    ChainsK
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15P
    ChainsL
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L15E
    ChainsM
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18P
    ChainsN
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L18E
    ChainsO
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L19E
    ChainsP
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L21E
    ChainsQ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L22P
    ChainsR
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L23P
    ChainsS
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24P
    ChainsT
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L24E
    ChainsU
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L29P
    ChainsV
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L30P
    ChainsW
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L31E
    ChainsX
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L32E
    ChainsY
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37AE
    ChainsZ
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L37E
    Chains1
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L39E
    Chains2
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L44E
    Chains3
    Organism ScientificHALOARCULA MARISMORTUI
    Organism Taxid2238
    StrainDT38

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ01239

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (11, 237)

Asymmetric/Biological Unit (11, 237)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2CD5Ligand/IonCADMIUM ION
3CL22Ligand/IonCHLORIDE ION
4ERY1Ligand/IonERYTHROMYCIN A
5K2Ligand/IonPOTASSIUM ION
6MG116Ligand/IonMAGNESIUM ION
7NA86Ligand/IonSODIUM ION
8OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
9OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
10PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
11UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE

(-) Sites  (232, 232)

Asymmetric Unit (232, 232)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREC 0:839 , A 0:2099 , A 0:2100 , A 0:2103 , A 0:2538 , G 0:2540 , G 0:2646BINDING SITE FOR RESIDUE ERY 0 9000
002AC2SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:3613 , HOH 0:7737 , HOH 0:9174BINDING SITE FOR RESIDUE MG 0 8001
003AC3SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , HOH 0:4320 , HOH 0:7715 , HOH 0:7716BINDING SITE FOR RESIDUE MG 0 8002
004AC4SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:3663 , HOH A:8811 , HOH A:8832BINDING SITE FOR RESIDUE MG 0 8003
005AC5SOFTWAREG 0:456 , A 0:459 , HOH 0:3780 , HOH 0:7722 , HOH 0:9045 , HOH 0:9781BINDING SITE FOR RESIDUE MG 0 8004
006AC6SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:3609 , HOH 0:7738 , HOH 0:7739BINDING SITE FOR RESIDUE MG 0 8005
007AC7SOFTWAREU 0:821 , C 0:822 , G 0:854 , HOH 0:3615 , HOH 0:3751 , HOH 0:9814BINDING SITE FOR RESIDUE MG 0 8006
008AC8SOFTWAREU 0:832 , A 0:1839 , A 0:1840 , HOH 0:3358 , HOH 0:7727 , HOH 0:9006BINDING SITE FOR RESIDUE MG 0 8007
009AC9SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:3627 , HOH 0:7731 , HOH 0:7814BINDING SITE FOR RESIDUE MG 0 8008
010BC1SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:3736 , HOH 0:7398 , HOH 0:7732 , HOH 0:7733 , NA 0:8558BINDING SITE FOR RESIDUE MG 0 8009
011BC2SOFTWAREG 0:836 , U 0:2615 , HOH 0:3837 , HOH 0:9364 , GLN B:230 , HOH B:8825BINDING SITE FOR RESIDUE MG 0 8010
012BC3SOFTWAREG 0:824 , G 0:854 , HOH 0:3956 , HOH 0:4286 , HOH 0:4419 , HOH 0:4522BINDING SITE FOR RESIDUE MG 0 8011
013BC4SOFTWAREG 0:28 , HOH 0:3229 , HOH 0:3645 , HOH 0:7815 , HOH 0:9037 , HOH 0:9639BINDING SITE FOR RESIDUE MG 0 8012
014BC5SOFTWAREG 0:877 , G 0:2623 , HOH 0:3639 , HOH 0:3652 , HOH 0:7746 , HOH 0:9019BINDING SITE FOR RESIDUE MG 0 8013
015BC6SOFTWAREA 0:2101 , G 0:2102 , G 0:2537 , HOH 0:3656 , HOH 0:4159 , HOH 0:7713 , HOH 0:9031BINDING SITE FOR RESIDUE MG 0 8014
016BC7SOFTWAREA 0:844 , A 0:1689 , HOH 0:3619 , HOH 0:7748 , HOH 0:9004 , HOH 0:9022BINDING SITE FOR RESIDUE MG 0 8015
017BC8SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:3743 , HOH 0:7740 , HOH 0:7741BINDING SITE FOR RESIDUE MG 0 8016
018BC9SOFTWAREG 0:456 , HOH 0:3941 , HOH 0:7364 , HOH 0:7723 , HOH 0:9416 , HOH C:8558BINDING SITE FOR RESIDUE MG 0 8017
019CC1SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3223 , HOH 0:3611 , HOH 0:7434 , HOH 0:7816BINDING SITE FOR RESIDUE MG 0 8018
020CC2SOFTWAREA 0:2011 , HOH 0:4146 , HOH 0:7211 , HOH 0:7742 , HOH 0:7743 , HOH 0:7744BINDING SITE FOR RESIDUE MG 0 8019
021CC3SOFTWAREC 0:1830 , HOH 0:7726 , HOH 0:7745 , HOH 0:9121 , HOH 0:9124 , HOH 0:9195BINDING SITE FOR RESIDUE MG 0 8020
022CC4SOFTWAREG 0:2304 , HOH 0:3635 , HOH 0:3636 , HOH 0:7729 , HOH 0:7730 , HOH 0:9969BINDING SITE FOR RESIDUE MG 0 8021
023CC5SOFTWAREG 0:2097 , G 0:2540 , HOH 0:3867 , HOH 0:7734 , HOH 0:9109 , HOH 0:9458BINDING SITE FOR RESIDUE MG 0 8022
024CC6SOFTWAREG 0:2616 , G 0:2617 , G 0:2618 , HOH 0:3625 , HOH 0:3819 , HOH 0:7750 , HOH 0:7751BINDING SITE FOR RESIDUE MG 0 8023
025CC7SOFTWAREA 0:1381 , HOH 0:5107 , HOH 0:7817 , HOH 0:7818 , HOH 0:9942BINDING SITE FOR RESIDUE MG 0 8024
026CC8SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4164 , HOH 0:7752 , HOH 0:7753 , HOH 0:7819BINDING SITE FOR RESIDUE MG 0 8025
027CC9SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:7754 , HOH 0:7755 , HOH 0:7756 , HOH 0:9395BINDING SITE FOR RESIDUE MG 0 8026
028DC1SOFTWAREC 0:240 , G 0:269 , HOH 0:3870 , HOH 0:4011 , HOH 0:4151 , HOH 0:7820BINDING SITE FOR RESIDUE MG 0 8027
029DC2SOFTWAREA 0:1448 , U 0:1677 , HOH 0:3675 , HOH 0:3696 , HOH 0:3708 , HOH S:8549BINDING SITE FOR RESIDUE MG 0 8028
030DC3SOFTWAREA 0:1502 , U 0:1503 , C 0:1679 , HOH 0:7758 , HOH 0:7759 , HOH 0:7760 , HOH 0:7761BINDING SITE FOR RESIDUE MG 0 8029
031DC4SOFTWAREU 0:1748 , U 0:1749 , HOH 0:3637 , HOH 0:7724 , HOH 0:7725 , HOH 0:7735BINDING SITE FOR RESIDUE MG 0 8030
032DC5SOFTWAREU 0:777 , C 0:778 , HOH 0:3278 , HOH 0:7763 , HOH 0:7764 , HOH 0:7765BINDING SITE FOR RESIDUE MG 0 8031
033DC6SOFTWAREU 0:2115 , HOH 0:3786 , HOH 0:4185 , HOH 0:9993 , HOH A:8848 , HOH A:8926BINDING SITE FOR RESIDUE MG 0 8032
034DC7SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3814 , HOH 0:9679BINDING SITE FOR RESIDUE MG 0 8033
035DC8SOFTWAREA 0:2302 , A 0:2303 , HOH 0:3640 , HOH 0:3767 , HOH 0:4857 , HOH 0:7766BINDING SITE FOR RESIDUE MG 0 8034
036DC9SOFTWAREG 0:1484 , HOH 0:3713 , HOH 0:7767 , HOH 0:7768 , HOH 0:7822 , HOH 0:7823BINDING SITE FOR RESIDUE MG 0 8035
037EC1SOFTWAREG 0:956 , HOH 0:3667 , HOH 0:7769 , HOH 0:7770 , HOH 0:7771 , HOH 0:9370BINDING SITE FOR RESIDUE MG 0 8036
038EC2SOFTWAREA 0:2553 , A 0:2576 , HOH 0:3138 , HOH 0:3213 , HOH 0:3646 , HOH 0:7824 , HOH 0:9077BINDING SITE FOR RESIDUE MG 0 8037
039EC3SOFTWAREG 0:2271 , HOH 0:3623 , HOH 0:3647 , HOH 0:3668 , HOH 0:3670 , HOH 0:7773 , HOH 0:9283BINDING SITE FOR RESIDUE MG 0 8038
040EC4SOFTWAREU 0:115 , HOH 0:3962 , HOH 0:5086 , HOH 0:7774 , HOH 0:7775 , HOH 0:9916BINDING SITE FOR RESIDUE MG 0 8039
041EC5SOFTWAREU 0:392 , HOH 0:3787 , HOH 0:4636 , HOH 0:7826 , HOH 0:7827 , HOH 0:9693BINDING SITE FOR RESIDUE MG 0 8040
042EC6SOFTWAREC 0:195 , G 0:196 , A 0:227 , C 0:228 , HOH 0:4103 , HOH 0:4196 , HOH 0:5362BINDING SITE FOR RESIDUE MG 0 8041
043EC7SOFTWAREU 0:1309 , U 0:1346 , HOH 0:3655 , HOH 0:4415 , HOH 0:7776 , HOH 0:9438BINDING SITE FOR RESIDUE MG 0 8042
044EC8SOFTWAREG 0:816 , G 0:817 , HOH 0:7388 , HOH 0:7828 , MG 0:8105 , HOH 0:9818BINDING SITE FOR RESIDUE MG 0 8043
045EC9SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3297 , GLY R:65 , HOH R:8886BINDING SITE FOR RESIDUE MG 0 8044
046FC1SOFTWAREG 0:1979 , HOH 0:7777 , HOH 0:7829 , HOH 0:7830 , HOH 0:7831BINDING SITE FOR RESIDUE MG 0 8045
047FC2SOFTWAREG 0:1794 , HOH 0:7272 , HOH 0:7832 , HOH 0:7833BINDING SITE FOR RESIDUE MG 0 8046
048FC3SOFTWAREA 0:1098 , HOH 0:3132 , HOH 0:6255 , HOH 0:7847BINDING SITE FOR RESIDUE MG 0 8047
049FC4SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:5861 , HOH 0:6247 , HOH 0:7868BINDING SITE FOR RESIDUE MG 0 8048
050FC5SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:7835 , HOH 0:7836BINDING SITE FOR RESIDUE MG 0 8049
051FC6SOFTWAREC 0:2248 , HOH 0:7295BINDING SITE FOR RESIDUE MG 0 8050
052FC7SOFTWAREG 0:641 , HOH 0:4099 , HOH 0:7778 , HOH 0:7779BINDING SITE FOR RESIDUE MG 0 8051
053FC8SOFTWAREU 0:1125 , C 0:1129 , HOH 0:3621 , HOH 0:7849 , G 9:92 , HOH 9:8590 , HOH 9:8616BINDING SITE FOR RESIDUE MG 0 8052
054FC9SOFTWAREG 0:471 , HOH 0:3045 , HOH 0:4395 , HOH 0:5600 , HOH 0:9202 , HOH 0:9241BINDING SITE FOR RESIDUE MG 0 8053
055GC1SOFTWAREC 0:162 , U 0:2276 , HOH 0:7728 , HOH 0:7780 , HOH 0:7781 , HOH 0:9434BINDING SITE FOR RESIDUE MG 0 8054
056GC2SOFTWAREA 0:2757 , HOH 0:3665 , HOH 0:3971 , HOH 0:7798 , ASN B:335 , HOH B:8840BINDING SITE FOR RESIDUE MG 0 8056
057GC3SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5000 , GLN A:207 , HOH A:8929BINDING SITE FOR RESIDUE MG 0 8057
058GC4SOFTWAREG 0:2013 , HOH 0:3761 , HOH 0:7782 , HOH 0:7783 , HOH A:8927 , HOH A:8929BINDING SITE FOR RESIDUE MG 0 8058
059GC5SOFTWAREG 0:2618 , HOH 0:3719 , HOH 0:4048 , HOH 0:7736 , MG 0:8085 , HOH 0:9036 , HOH 0:9040BINDING SITE FOR RESIDUE MG 0 8059
060GC6SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:7784 , HOH 0:7785 , HOH 0:7786 , HOH 0:9167BINDING SITE FOR RESIDUE MG 0 8060
061GC7SOFTWAREA 0:1369 , U 0:2650 , HOH 0:7787 , HOH 0:7788 , HOH 0:7789 , HOH 0:9824BINDING SITE FOR RESIDUE MG 0 8061
062GC8SOFTWAREG 0:1489 , G 0:1491 , HOH 0:3630 , HOH 0:3955 , HOH 0:6157 , HOH 0:9397BINDING SITE FOR RESIDUE MG 0 8062
063GC9SOFTWAREHOH 0:4176 , HOH 0:6982 , HOH 0:7405 , HOH 0:7721 , HOH 0:7797 , HOH 0:7850BINDING SITE FOR RESIDUE MG 0 8063
064HC1SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3750 , HOH 0:3758 , HOH 0:9591BINDING SITE FOR RESIDUE MG 0 8064
065HC2SOFTWAREC 0:1872 , G 0:1873 , HOH 0:7863 , ASP A:26BINDING SITE FOR RESIDUE MG 0 8066
066HC3SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:7791 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8067
067HC4SOFTWAREA 0:2568 , HOH 0:3749 , HOH 0:4811 , HOH 0:6208 , HOH 0:7851 , HOH 0:9736BINDING SITE FOR RESIDUE MG 0 8068
068HC5SOFTWAREA 0:166 , G 0:219 , HOH 0:3815 , HOH 0:4947 , HOH 0:9122BINDING SITE FOR RESIDUE MG 0 8070
069HC6SOFTWAREHOH 0:4108 , HOH 0:6035 , HOH 0:7392 , HOH 0:7524 , HOH 0:7795 , HOH 0:7796BINDING SITE FOR RESIDUE MG 0 8071
070HC7SOFTWAREU 0:954 , HOH 0:3234 , HOH 0:3993 , HOH 0:7387 , HOH 0:7794 , HOH 0:7852BINDING SITE FOR RESIDUE MG 0 8072
071HC8SOFTWAREA 0:1286 , A 0:1287 , HOH 0:7792 , HOH 0:7853 , HOH W:7804 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8074
072HC9SOFTWAREA 0:907 , A 0:908 , HOH 0:3634 , HOH 0:3913 , HOH 0:4926 , HOH 0:7793BINDING SITE FOR RESIDUE MG 0 8075
073IC1SOFTWAREC 0:880 , U 0:883 , HOH 0:3620 , HOH 0:7801 , HOH 0:7802 , HOH 0:9240BINDING SITE FOR RESIDUE MG 0 8077
074IC2SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:3608 , HOH 0:3614 , HOH 0:3626BINDING SITE FOR RESIDUE MG 0 8079
075IC3SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4201 , HOH 0:4488 , HOH 0:7803 , HOH 0:7856BINDING SITE FOR RESIDUE MG 0 8080
076IC4SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:4094 , HOH 0:9613BINDING SITE FOR RESIDUE MG 0 8081
077IC5SOFTWAREC 0:1436 , A 0:1437 , HOH 0:5143 , HOH 0:5230 , HOH 0:7864 , HOH P:214BINDING SITE FOR RESIDUE MG 0 8082
078IC6SOFTWAREA 0:1754 , HOH 0:3704 , HOH 0:4147 , HOH 0:6340 , HOH 0:7804 , HOH 0:7857BINDING SITE FOR RESIDUE MG 0 8083
079IC7SOFTWAREA 0:1742 , HOH 0:3632 , HOH 0:7805 , HOH 0:9249 , HOH 0:9376 , HOH 0:9754BINDING SITE FOR RESIDUE MG 0 8084
080IC8SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3785 , HOH 0:4354 , HOH 0:4481 , MG 0:8059 , HOH 0:9036 , HOH 0:9603BINDING SITE FOR RESIDUE MG 0 8085
081IC9SOFTWAREA 0:532 , U 0:533 , HOH 0:3730 , HOH 0:3972 , HOH 0:7806 , HOH 0:7807BINDING SITE FOR RESIDUE MG 0 8086
082JC1SOFTWAREA 0:682 , G 0:683 , HOH 0:7865BINDING SITE FOR RESIDUE MG 0 8087
083JC2SOFTWAREG 0:2540 , G 0:2611 , HOH 0:3049 , HOH 0:4289 , NA 0:8539 , HOH 0:9062BINDING SITE FOR RESIDUE MG 0 8088
084JC3SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:7808 , HOH 0:7858 , HOH 0:7859BINDING SITE FOR RESIDUE MG 0 8089
085JC4SOFTWAREA 0:2103 , U 0:2478 , HOH 0:3612 , HOH 0:3794BINDING SITE FOR RESIDUE MG 0 8090
086JC5SOFTWAREG 0:918 , HOH 0:3325 , HOH 0:6465 , HOH 0:7809 , HOH 0:9091 , HOH 0:9549BINDING SITE FOR RESIDUE MG 0 8091
087JC6SOFTWAREC 0:1844 , HOH 0:3642 , HOH 0:3657 , HOH 0:7860BINDING SITE FOR RESIDUE MG 0 8092
088JC7SOFTWAREA 0:1070 , G 0:1071 , HOH 0:3648 , HOH 0:3679 , HOH 0:3720 , HOH 0:9685BINDING SITE FOR RESIDUE MG 0 8093
089JC8SOFTWAREU 0:1096 , C 0:1257 , HOH 0:7810 , HOH 0:7861BINDING SITE FOR RESIDUE MG 0 8094
090JC9SOFTWAREG 0:1848 , G 0:1849 , HOH 0:3660 , HOH 0:3697 , HOH 0:3833 , HOH 0:3862 , MG 0:8115BINDING SITE FOR RESIDUE MG 0 8096
091KC1SOFTWAREG 0:863 , U 0:864 , HOH 0:3340 , HOH 0:3669 , HOH 0:3673 , HOH 0:5538BINDING SITE FOR RESIDUE MG 0 8097
092KC2SOFTWAREA 0:907 , HOH 0:3369 , HOH 0:3681 , HOH 0:3745 , HOH 0:9948 , LYS Y:145 , HOH Y:8867BINDING SITE FOR RESIDUE MG 0 8098
093KC3SOFTWAREA 0:2612 , HOH 0:3018 , HOH 0:3664 , HOH 0:3676BINDING SITE FOR RESIDUE MG 0 8099
094KC4SOFTWAREG 0:2080 , HOH 0:3764 , HOH 0:4247 , HOH 0:5491 , HOH 0:7811BINDING SITE FOR RESIDUE MG 0 8100
095KC5SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:3744 , HOH 0:4614 , HOH 0:6884BINDING SITE FOR RESIDUE MG 0 8101
096KC6SOFTWAREA 0:2434 , U 0:2458 , HOH 0:7869 , HOH 0:9252 , HOH 0:9898 , HOH 3:8824BINDING SITE FOR RESIDUE MG 0 8102
097KC7SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:7862BINDING SITE FOR RESIDUE MG 0 8103
098KC8SOFTWAREC 0:2104 , C 0:2105 , HOH 0:7718BINDING SITE FOR RESIDUE MG 0 8104
099KC9SOFTWAREG 0:817 , HOH 0:3597 , HOH 0:7388 , HOH 0:7828 , MG 0:8043 , HOH P:188 , HOH P:208BINDING SITE FOR RESIDUE MG 0 8105
100LC1SOFTWAREA 0:1106 , A 0:1107 , HOH 0:7837 , HOH 0:7838 , HOH 0:7839 , HOH 0:7840BINDING SITE FOR RESIDUE MG 0 8106
101LC2SOFTWAREG 0:2000 , G 0:2001 , HOH 0:6079 , HOH 0:7462 , HOH 0:7842 , HOH 0:7843 , HOH 0:7844BINDING SITE FOR RESIDUE MG 0 8107
102LC3SOFTWAREU 0:903 , A 0:1357 , HOH 0:3923 , HOH 0:5385 , HOH 0:6014 , HOH 0:9510BINDING SITE FOR RESIDUE MG 0 8109
103LC4SOFTWAREG 0:2609 , HOH 0:3301 , HOH 0:3694 , HOH 0:3718 , HOH 0:5586 , HOH 0:5733BINDING SITE FOR RESIDUE MG 0 8110
104LC5SOFTWAREA 0:187 , HOH 0:3724 , HOH 0:3765 , HOH 0:9128 , HOH 0:9331 , HOH 0:9572BINDING SITE FOR RESIDUE MG 0 8111
105LC6SOFTWAREA 0:2112 , HOH 0:3750 , HOH 0:3921 , HOH 0:6113 , HOH 0:6384 , HOH 0:9591BINDING SITE FOR RESIDUE MG 0 8112
106LC7SOFTWAREA 0:2430 , HOH 0:3666 , HOH 0:3961 , HOH 0:4807 , HOH 0:9351 , HOH 0:9452BINDING SITE FOR RESIDUE MG 0 8113
107LC8SOFTWAREHOH 0:4282 , HOH 0:4299 , HOH 0:6583 , HOH 0:6712 , HOH A:8852BINDING SITE FOR RESIDUE MG 0 8114
108LC9SOFTWAREG 0:1849 , U 0:1850 , HOH 0:3660 , HOH 0:3686 , HOH 0:3862 , HOH 0:6712 , MG 0:8096 , HOH A:8852BINDING SITE FOR RESIDUE MG 0 8115
109MC1SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:4629 , HOH 0:6541 , HOH 0:9223BINDING SITE FOR RESIDUE MG 0 8116
110MC2SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 8401
111MC3SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:9014 , HOH 0:9110 , HOH 0:9145BINDING SITE FOR RESIDUE K 0 8402
112MC4SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3172 , HOH 0:4959BINDING SITE FOR RESIDUE NA 0 8501
113MC5SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:4541 , HOH 0:5668 , HOH 0:7753BINDING SITE FOR RESIDUE NA 0 8502
114MC6SOFTWAREA 0:643 , G 0:644 , U 0:904 , C 0:1353 , G 0:1354 , ARG L:8BINDING SITE FOR RESIDUE NA 0 8503
115MC7SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:4085 , HOH 0:4694 , HOH 0:5767BINDING SITE FOR RESIDUE NA 0 8505
116MC8SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9126BINDING SITE FOR RESIDUE NA 0 8506
117MC9SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 8507
118NC1SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:3409BINDING SITE FOR RESIDUE NA 0 8508
119NC2SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:4500BINDING SITE FOR RESIDUE NA 0 8510
120NC3SOFTWAREG 0:2524 , G 0:2525 , HOH 0:3571 , HOH 0:4646 , HOH 0:9181BINDING SITE FOR RESIDUE NA 0 8511
121NC4SOFTWAREG 0:2399 , HOH 0:3834 , HOH 0:5058 , HOH 0:5104 , HOH 0:9958BINDING SITE FOR RESIDUE NA 0 8513
122NC5SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3133 , HOH 0:9332 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8514
123NC6SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:9688BINDING SITE FOR RESIDUE NA 0 8515
124NC7SOFTWAREC 0:896 , A 0:897 , HOH 0:6298 , HOH 0:7653BINDING SITE FOR RESIDUE NA 0 8516
125NC8SOFTWAREG 0:1416 , G 0:1417 , HOH 0:9278 , TRP 2:42 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 0 8517
126NC9SOFTWAREG 0:2543 , G 0:2544 , HOH 0:3462 , HOH 0:3927 , NA 0:8520 , HOH 0:9210BINDING SITE FOR RESIDUE NA 0 8518
127OC1SOFTWAREA 0:2465 , G 0:2466 , HOH 0:4257 , HOH 0:6029 , HOH 0:9058 , ASP L:36BINDING SITE FOR RESIDUE NA 0 8519
128OC2SOFTWAREG 0:2543 , G 0:2544 , G 0:2611 , U 0:2615 , NA 0:8518 , HOH 0:9055 , HOH 0:9086 , HOH 0:9745BINDING SITE FOR RESIDUE NA 0 8520
129OC3SOFTWAREG 0:836 , U 0:837 , A 0:1736 , A 0:1737 , ARG B:229BINDING SITE FOR RESIDUE NA 0 8521
130OC4SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:3654 , HOH 0:4475BINDING SITE FOR RESIDUE NA 0 8523
131OC5SOFTWAREA 0:45 , C 0:130 , U 0:146 , G 0:147 , HOH 0:9496BINDING SITE FOR RESIDUE NA 0 8524
132OC6SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3278 , HOH 0:7629 , HOH 0:9627BINDING SITE FOR RESIDUE NA 0 8525
133OC7SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 0 8526
134OC8SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3207 , HOH 0:9035 , HOH 0:9732BINDING SITE FOR RESIDUE NA 0 8527
135OC9SOFTWAREG 0:56 , A 0:59 , G 0:61 , HOH 0:5200 , HOH 0:6460BINDING SITE FOR RESIDUE NA 0 8528
136PC1SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:6559BINDING SITE FOR RESIDUE NA 0 8529
137PC2SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9234BINDING SITE FOR RESIDUE NA 0 8530
138PC3SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:9301BINDING SITE FOR RESIDUE NA 0 8531
139PC4SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7049BINDING SITE FOR RESIDUE NA 0 8532
140PC5SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939BINDING SITE FOR RESIDUE NA 0 8533
141PC6SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5236BINDING SITE FOR RESIDUE NA 0 8534
142PC7SOFTWAREG 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:9878BINDING SITE FOR RESIDUE NA 0 8535
143PC8SOFTWAREG 0:1706 , G 0:1707 , HOH 0:5323 , HOH 0:7323 , HOH 0:7656 , HOH 0:9931BINDING SITE FOR RESIDUE NA 0 8536
144PC9SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , HOH 0:3033 , HOH 0:4289 , MG 0:8088BINDING SITE FOR RESIDUE NA 0 8539
145QC1SOFTWAREU 0:1740 , U 0:1741 , G 0:2033BINDING SITE FOR RESIDUE NA 0 8540
146QC2SOFTWAREG 0:681 , A 0:682 , G 0:683BINDING SITE FOR RESIDUE NA 0 8541
147QC3SOFTWAREG 0:892 , C 0:893 , HOH 0:5610 , HOH 0:6253BINDING SITE FOR RESIDUE NA 0 8542
148QC4SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:9222BINDING SITE FOR RESIDUE NA 0 8544
149QC5SOFTWAREA 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045BINDING SITE FOR RESIDUE NA 0 8549
150QC6SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:6933BINDING SITE FOR RESIDUE NA 0 8550
151QC7SOFTWAREA 0:955 , HOH 0:5244 , HOH 0:6587 , C 9:81 , U 9:82BINDING SITE FOR RESIDUE NA 0 8552
152QC8SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:4865 , HOH 0:9212 , GLY L:14BINDING SITE FOR RESIDUE NA 0 8553
153QC9SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:4808BINDING SITE FOR RESIDUE NA 0 8554
154RC1SOFTWAREG 0:1119 , C 0:1243 , THR J:47 , HOH J:3661BINDING SITE FOR RESIDUE NA 0 8555
155RC2SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:9455BINDING SITE FOR RESIDUE NA 0 8556
156RC3SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:6259BINDING SITE FOR RESIDUE NA 0 8557
157RC4SOFTWAREG 0:2611 , HOH 0:3867 , HOH 0:7398 , HOH 0:7749 , MG 0:8009 , HOH 0:9334 , HOH 0:9487BINDING SITE FOR RESIDUE NA 0 8558
158RC5SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109BINDING SITE FOR RESIDUE NA 0 8559
159RC6SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:5941BINDING SITE FOR RESIDUE NA 0 8560
160RC7SOFTWAREU 0:837 , HOH 0:4583 , HOH 0:4894 , HOH 0:7312 , GLN B:230BINDING SITE FOR RESIDUE NA 0 8561
161RC8SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277BINDING SITE FOR RESIDUE NA 0 8562
162RC9SOFTWAREU 0:1359 , C 0:1360 , HOH 0:3475BINDING SITE FOR RESIDUE NA 0 8563
163SC1SOFTWAREG 0:636 , U 0:2057 , G 0:2058 , HOH 0:9595 , HOH 0:9821BINDING SITE FOR RESIDUE NA 0 8564
164SC2SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 0 8565
165SC3SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3878 , HOH 0:9872 , HOH 0:9891BINDING SITE FOR RESIDUE NA 0 8566
166SC4SOFTWAREG 0:464 , G 0:475 , HOH 0:4474 , HOH 0:4596 , HOH 0:9833 , ARG C:55BINDING SITE FOR RESIDUE NA 0 8567
167SC5SOFTWAREG 0:798 , C 0:799 , G 0:814 , U 0:815 , HOH 0:3882BINDING SITE FOR RESIDUE NA 0 8568
168SC6SOFTWAREU 0:391 , U 0:392 , A 0:395 , U 0:398 , HOH 0:4411 , HOH 0:6554 , ARG 3:42BINDING SITE FOR RESIDUE NA 0 8569
169SC7SOFTWAREG 0:1832 , A 0:2022 , HOH 0:4098 , HOH 0:6573 , HOH 0:9103BINDING SITE FOR RESIDUE NA 0 8570
170SC8SOFTWAREG 0:2491 , U 0:2492 , G 0:2529 , C 0:2530 , HOH 0:9628BINDING SITE FOR RESIDUE NA 0 8571
171SC9SOFTWAREU 0:919 , G 0:921 , A 0:922 , G 0:924 , HOH 0:9274BINDING SITE FOR RESIDUE NA 0 8572
172TC1SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:3677 , HOH 0:7276BINDING SITE FOR RESIDUE NA 0 8573
173TC2SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 0 8574
174TC3SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9263BINDING SITE FOR RESIDUE NA 0 8575
175TC4SOFTWAREA 0:632 , C 0:633 , U 0:2535 , C 0:2536 , A 0:2538 , U 0:2539 , HOH 0:3644 , HOH 0:4846BINDING SITE FOR RESIDUE NA 0 8576
176TC5SOFTWAREG 0:911 , U 0:1293 , G 0:1295 , HOH 0:6327BINDING SITE FOR RESIDUE NA 0 8577
177TC6SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3211 , HIS L:18 , HOH L:8831BINDING SITE FOR RESIDUE NA 0 8578
178TC7SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:3711 , HOH 0:4423BINDING SITE FOR RESIDUE NA 0 8579
179TC8SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , C 0:2593 , HOH 0:3688 , HOH 0:7051 , HOH 0:9330BINDING SITE FOR RESIDUE NA 0 8581
180TC9SOFTWAREG 0:2772 , G 0:2773 , HOH 0:4365BINDING SITE FOR RESIDUE NA 0 8582
181UC1SOFTWAREC 0:197 , HOH 0:5008 , HOH 0:5240 , HOH 0:6553BINDING SITE FOR RESIDUE NA 0 8584
182UC2SOFTWAREG 0:1077 , A 0:1079 , HOH 0:7649BINDING SITE FOR RESIDUE NA 0 8585
183UC3SOFTWAREG 0:1676 , LYS 2:2BINDING SITE FOR RESIDUE CL 0 8803
184UC4SOFTWAREC 0:197 , G 0:201BINDING SITE FOR RESIDUE CL 0 8805
185UC5SOFTWAREC 0:2388 , PHE Q:52 , HIS Q:53BINDING SITE FOR RESIDUE CL 0 8811
186UC6SOFTWAREG 0:2582 , A 0:2596 , HOH 0:5083 , LYS K:14 , SER K:33BINDING SITE FOR RESIDUE CL 0 8812
187UC7SOFTWAREG 0:1299 , G 0:1300 , A 0:1328 , G 0:1329BINDING SITE FOR RESIDUE CL 0 8813
188UC8SOFTWAREG 0:644 , HIS L:13BINDING SITE FOR RESIDUE CL 0 8814
189UC9SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 8815
190VC1SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 8816
191VC2SOFTWAREC 0:594 , U 0:595 , ARG Y:115 , HOH Y:8854BINDING SITE FOR RESIDUE CL 0 8817
192VC3SOFTWAREG 0:1072 , G 0:1087 , HOH 0:5315BINDING SITE FOR RESIDUE CL 0 8822
193VC4SOFTWAREG 9:21 , A 9:56 , A 9:57 , HOH 9:8712BINDING SITE FOR RESIDUE MG 9 8095
194VC5SOFTWAREC 9:40BINDING SITE FOR RESIDUE NA 9 8551
195VC6SOFTWAREG 9:21 , G 9:22 , U 9:55 , A 9:57 , G 9:58BINDING SITE FOR RESIDUE NA 9 8583
196VC7SOFTWAREHOH 0:3966 , HOH 0:9932 , HOH A:8823 , HOH A:8849 , HOH A:8899 , HOH A:8928BINDING SITE FOR RESIDUE MG A 8065
197VC8SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:8855 , HOH A:8898BINDING SITE FOR RESIDUE NA A 8545
198VC9SOFTWARELYS A:178BINDING SITE FOR RESIDUE CL A 8809
199WC1SOFTWAREHOH 0:3755 , HOH 0:6402 , HOH 0:7680 , HOH B:8852 , HOH B:8968 , HOH B:8969BINDING SITE FOR RESIDUE MG B 8055
200WC2SOFTWAREARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 8819
201WC3SOFTWAREASP C:45 , THR C:94 , LYS C:96BINDING SITE FOR RESIDUE NA C 8504
202WC4SOFTWAREA 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , THR H:161 , PRO H:162BINDING SITE FOR RESIDUE NA H 8509
203WC5SOFTWAREC 0:2287 , ARG H:117BINDING SITE FOR RESIDUE NA H 8522
204WC6SOFTWAREHOH 0:5742 , HOH 0:9486 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69BINDING SITE FOR RESIDUE NA J 8546
205WC7SOFTWAREILE J:127 , LYS J:128 , HOH J:4193BINDING SITE FOR RESIDUE CL J 8801
206WC8SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 8802
207WC9SOFTWAREGLY J:64 , ASN J:65 , GLY J:68 , TYR J:69BINDING SITE FOR RESIDUE CL J 8821
208XC1SOFTWAREHOH 0:3419 , HOH 0:4237 , HOH 0:6027 , ASN K:42 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8069
209XC2SOFTWAREARG L:27 , GLY L:28 , GLY L:29 , GLY L:31 , ALA L:33 , GLU L:39BINDING SITE FOR RESIDUE NA L 8580
210XC3SOFTWAREARG L:53BINDING SITE FOR RESIDUE CL L 8810
211XC4SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:8927BINDING SITE FOR RESIDUE NA M 8547
212XC5SOFTWARESER M:106 , ARG M:113 , VAL M:114 , ARG M:158 , VAL M:159BINDING SITE FOR RESIDUE CL M 8818
213XC6SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 8807
214XC7SOFTWAREHOH 0:5998 , HIS O:40 , HOH O:5650BINDING SITE FOR RESIDUE CD O 8705
215XC8SOFTWAREASN O:44BINDING SITE FOR RESIDUE CL O 8808
216XC9SOFTWAREASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795BINDING SITE FOR RESIDUE NA Q 8548
217YC1SOFTWAREHOH 0:5902 , SER R:70 , VAL R:72 , HOH R:8822 , HOH R:8824BINDING SITE FOR RESIDUE NA R 8537
218YC2SOFTWAREU 0:2659 , G 0:2660 , VAL R:72 , TRP R:75 , HOH R:8813 , HOH R:8824BINDING SITE FOR RESIDUE NA R 8538
219YC3SOFTWAREU 0:12 , LYS R:60 , ASN R:63BINDING SITE FOR RESIDUE NA R 8586
220YC4SOFTWARELYS R:118 , HOH R:8809BINDING SITE FOR RESIDUE CL R 8806
221YC5SOFTWAREHIS S:7 , GLU S:61 , HOH S:8525BINDING SITE FOR RESIDUE NA S 8512
222YC6SOFTWAREGLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8073
223YC7SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA T 8543
224YC8SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 8701
225YC9SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:8859 , HOH Y:8880 , HOH Y:8914BINDING SITE FOR RESIDUE MG Y 8108
226ZC1SOFTWAREARG Y:169BINDING SITE FOR RESIDUE CL Y 8820
227ZC2SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 8703
228ZC3SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 8702
229ZC4SOFTWAREHOH 0:6827 , HOH 0:7800 , HOH 0:7854 , HOH 0:7855BINDING SITE FOR RESIDUE MG 2 8076
230ZC5SOFTWAREGLY 3:45 , GLY 3:47 , ASP 3:49 , HOH 3:8827 , HOH 3:8881 , HOH 3:8882BINDING SITE FOR RESIDUE MG 3 8078
231ZC6SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74 , HOH 3:8865BINDING SITE FOR RESIDUE CD 3 8704
232ZC7SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 8804

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YI2)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1YI2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1yi2 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1yi211 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1yi2100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1yi2101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......ee.........ee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1yi2 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1yi221 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1yi2200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1yi2201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1yi2 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1yi231 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1yi2300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeee........eeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1yi2 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1yi2 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1yi2a2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1yi2a1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1yi2A01 A:1-78 Nucleic acid-binding proteins                                  ---1yi2A02 A:82-159  [code=2.30.30.30, no name defined]                          1yi2A03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1yi2A02 A:10-82                                             -----Ribosomal_L2_C-1yi2A01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeeee.........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1yi2b1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1yi2B01 B:1-38,B:207-257              1yi2B02 B:39-77,B:189-206,B:258-337    1yi2B03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1yi2B02           1yi2B01 B:1-38,B:207-257                           1yi2B02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1yi2B01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee.....eehhhhhhh....hhhhhhh........................ee....eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1yi2c1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1yi2C00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1yi2C01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhh..............................ee..ee.........................hhhhhhhhhhhhhhh..hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yi2 C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1yi2d1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1yi2D00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1yi2D0     1 D:11-64                     ---Ribosomal_L5_C-1yi2D02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhhh...eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee..hhhhhh........hhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1yi2e1 E:1-79 Ribosomal protein L6                                            d1yi2e2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1yi2E01 E:1-79  [code=3.90.930.12, no name defined]                            1yi2E02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1yi2E01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1yi2E02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhhh............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1yi2f1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1yi2F00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1yi2F01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhheeeehhhhhhhhhhhh....eeee.....hhhhhhhhhhhhh....eeee.hhhhhhhhh.......eeeee....hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1yi2g1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1yi2 G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1yi2h1 H:4-166 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1yi2H00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee....hhhhh.eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh....eeeee.....eeeee..-----------........eeeeeeeee....eeeeeee...hhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1yi2i1 I:66-135 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1yi2I00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1yi2I01 I:66-134                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhh..............eeehhhhhhhhhhhh.......hhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1yi2 I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1yi2j1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1yi2J00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1yi2J01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhh....eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee..................hhhhh..eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1yi2k1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1yi2K00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1yi2K01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee...............hhhhh..hhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yi2 K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1yi2l1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1yi2L01 L:1-50                                    1yi2L02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1yi2L01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eeehhhhh.......eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yi2 L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1yi2m1 M:1-193 Ribosomal protein L15e                                                                                                                                                           - SCOP domains
               CATH domains 1yi2M00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1yi2M01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh...hhhhhhhhhhhhhhhh....eee.....hhhhhhhh.......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh...............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1yi2n1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1yi2N00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1yi2N01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhhh...eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yi2 N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1yi2o1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1yi2O00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1yi2O01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhh..eeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1yi2p1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1yi2P01 P:1-55  [code=1.10.1650.10, no name defined]   1yi2P02 P:56-88 Single Heli x bin1yi2P03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1yi2q1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1yi2Q00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1yi2Q01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhh.......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1yi2 Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1yi2r1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1yi2R00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1yi2R01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeeee.hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhh...hhhhheeeeeeeeeeeee..eee.hhh.eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yi2 R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1yi2s1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1yi2S00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1yi2S01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1yi2 S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1yi2t1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1yi2T00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1yi2T01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1yi2u1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1yi2U00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1yi2U01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1yi2 U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1yi2v1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1yi2V00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1yi2V01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1yi2 V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1yi2w1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1yi2W01 W:1-57,W:114-154                                 1yi2W02 W:58-113  [code=1.10.15.30, no name defined]    1yi2W01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1yi2W01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1yi2x1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1yi2X00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1yi2X01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1yi2 X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1yi2y1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1yi2Y01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee..hhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yi2 Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1yi2z1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1yi2Z00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1yi2Z01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh...........eeeee..eeee.....eee.......hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1yi2 Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric/Biological Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
01a1yi2D00D:10-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
02a1yi2F00F:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
03a1yi2S00S:1-81
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
04a1yi2N00N:1-186
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
05a1yi2W01W:1-57,W:114-154
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
06a1yi2B03B:78-188
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
07a1yi2M00M:1-194
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
08a1yi2C00C:1-246
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
09a1yi2H00H:4-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
10a1yi2E01E:1-79
10b1yi2E02E:80-172
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
11a1yi2J00J:4-145
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
12a1yi2R00R:1-150
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
13a1yi2O00O:1-115
13b1yi2L02L:51-149
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
14a1yi23003:1-92
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
15a1yi2X00X:7-88
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
16a1yi2L01L:1-50
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
17a1yi2A03A:160-237
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
18a1yi2B01B:1-38,B:207-257
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
19a1yi2W02W:58-113
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
20a1yi2P01P:1-55
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
21a1yi2I00I:66-135
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
22a1yi22002:1-49
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
23a1yi2V00V:1-65
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
24a1yi2P03P:89-143
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
25a1yi2P02P:56-88
(-)
Class: Mainly Beta (13760)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
26a1yi2B02B:39-77,B:189-206,B:258-337
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
27a1yi2A01A:1-78
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
28a1yi2K00K:1-132
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
29a1yi2U00U:4-56
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
30a1yi2A02A:82-159
30b1yi2T00T:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
31a1yi2Q00Q:1-95
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid:2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt38. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt38. (1)
32a1yi21001:1-56
32b1yi2Z00Z:10-82

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ERY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yi2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P606171ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P158251jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P141221c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P291981ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P224501c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P606181ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P127371ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P127331ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P141231ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P141191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P127341ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P109701ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P127321ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P141161ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P109721ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P109711ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P202761c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P141211ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P181381ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P127361ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P606191ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P324101ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P224521ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P202791ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P324111ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P127351ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P141241ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P141351c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P127431ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yhq 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YI2)