Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AZITHROMYCIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI
 
Authors :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Date :  10 Jan 05  (Deposition) - 26 Apr 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,0,1,2,3,9
Keywords :  Azithromycin, Antibiotic Complexes, Mutated 50S Subunits, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Tu, G. Blaha, P. B. Moore, T. A. Steitz
Structures Of Mlsbk Antibiotics Bound To Mutated Large Ribosomal Subunits Provide A Structural Explanation For Resistance.
Cell(Cambridge, Mass. ) V. 121 257 2005
PubMed-ID: 15851032  |  Reference-DOI: 10.1016/J.CELL.2005.02.005

(-) Compounds

Molecule 1 - 23S RIBOSOMAL RNA
    Chains: 0
    Mutation: YES
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Other Details: ENCODED BY RRNA OPERON
    Strain: DT41
 
Molecule 2 - 5S RIBOSOMAL RNA
    Chains: 9
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 3 - 50S RIBOSOMAL PROTEIN L2P
    Chains: A
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 4 - 50S RIBOSOMAL PROTEIN L3P
    Chains: B
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 5 - 50S RIBOSOMAL PROTEIN L4E
    Chains: C
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 6 - 50S RIBOSOMAL PROTEIN L5P
    Chains: D
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 7 - 50S RIBOSOMAL PROTEIN L6P
    Chains: E
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 8 - 50S RIBOSOMAL PROTEIN L7AE
    Chains: F
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 9 - ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
    Chains: G
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 10 - 50S RIBOSOMAL PROTEIN L10E
    Chains: H
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 11 - 50S RIBOSOMAL PROTEIN L11P
    Chains: I
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 12 - 50S RIBOSOMAL PROTEIN L13P
    Chains: J
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 13 - 50S RIBOSOMAL PROTEIN L14P
    Chains: K
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 14 - 50S RIBOSOMAL PROTEIN L15P
    Chains: L
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 15 - 50S RIBOSOMAL PROTEIN L15E
    Chains: M
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 16 - 50S RIBOSOMAL PROTEIN L18P
    Chains: N
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 17 - 50S RIBOSOMAL PROTEIN L18E
    Chains: O
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 18 - 50S RIBOSOMAL PROTEIN L19E
    Chains: P
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 19 - 50S RIBOSOMAL PROTEIN L21E
    Chains: Q
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 20 - 50S RIBOSOMAL PROTEIN L22P
    Chains: R
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 21 - 50S RIBOSOMAL PROTEIN L23P
    Chains: S
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 22 - 50S RIBOSOMAL PROTEIN L24P
    Chains: T
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 23 - 50S RIBOSOMAL PROTEIN L24E
    Chains: U
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 24 - 50S RIBOSOMAL PROTEIN L29P
    Chains: V
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 25 - 50S RIBOSOMAL PROTEIN L30P
    Chains: W
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 26 - 50S RIBOSOMAL PROTEIN L31E
    Chains: X
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 27 - 50S RIBOSOMAL PROTEIN L32E
    Chains: Y
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 28 - 50S RIBOSOMAL PROTEIN L37AE
    Chains: Z
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 29 - 50S RIBOSOMAL PROTEIN L37E
    Chains: 1
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 30 - 50S RIBOSOMAL PROTEIN L39E
    Chains: 2
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41
 
Molecule 31 - 50S RIBOSOMAL PROTEIN L44E
    Chains: 3
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238
    Strain: DT41

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031
Asymmetric/Biological Unit : ABCDEFGHIJKLMNOPQRSTUVWXYZ01239

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (12, 311)

Asymmetric/Biological Unit (12, 311)
No.NameCountTypeFull Name
11MA1Mod. Nucleotide6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE
2CD5Ligand/IonCADMIUM ION
3CL22Ligand/IonCHLORIDE ION
4K2Ligand/IonPOTASSIUM ION
5MG93Ligand/IonMAGNESIUM ION
6NA75Ligand/IonSODIUM ION
7OMG1Mod. NucleotideO2'-METHYLGUANOSINE-5'-MONOPHOSPHATE
8OMU1Mod. NucleotideO2'-METHYLURIDINE 5'-MONOPHOSPHATE
9PSU1Mod. NucleotidePSEUDOURIDINE-5'-MONOPHOSPHATE
10SR108Ligand/IonSTRONTIUM ION
11UR31Mod. Nucleotide3-METHYLURIDINE-5'-MONOPHOSHATE
12ZIT1Ligand/IonAZITHROMYCIN

(-) Sites  (305, 305)

Asymmetric Unit (305, 305)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREC 0:839 , A 0:2099 , A 0:2100 , A 0:2103 , A 0:2538 , G 0:2540 , U 0:2645 , G 0:2646BINDING SITE FOR RESIDUE ZIT 0 9500
002AC2SOFTWAREG 0:2482 , A 0:2483 , C 0:2533 , C 0:2534 , HOH 0:4111 , HOH 0:8293 , HOH 0:9675BINDING SITE FOR RESIDUE MG 0 8001
003AC3SOFTWAREG 0:627 , A 0:2483 , C 0:2534 , HOH 0:4813 , HOH 0:8271 , HOH 0:8272BINDING SITE FOR RESIDUE MG 0 8002
004AC4SOFTWAREA 0:876 , G 0:877 , A 0:2624 , HOH 0:4163 , HOH A:8980 , HOH A:8999BINDING SITE FOR RESIDUE MG 0 8003
005AC5SOFTWAREG 0:456 , A 0:459 , HOH 0:3279 , HOH 0:4278 , HOH 0:8278 , HOH 0:9545BINDING SITE FOR RESIDUE MG 0 8004
006AC6SOFTWAREA 0:1836 , U 0:1838 , A 0:1839 , HOH 0:4108 , HOH 0:8294 , HOH 0:8295BINDING SITE FOR RESIDUE MG 0 8005
007AC7SOFTWAREU 0:919 , C 0:2464 , A 0:2465 , HOH 0:4125 , HOH 0:8287 , HOH 0:8367BINDING SITE FOR RESIDUE MG 0 8006
008AC8SOFTWAREU 0:2610 , G 0:2611 , A 0:2612 , HOH 0:4234 , HOH 0:7878 , HOH 0:8288 , HOH 0:8289BINDING SITE FOR RESIDUE MG 0 8007
009AC9SOFTWAREG 0:28 , HOH 0:3139 , HOH 0:3729 , HOH 0:4144 , HOH 0:8368 , HOH 0:9537BINDING SITE FOR RESIDUE MG 0 8008
010AD1SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3560 , HOH 0:4754BINDING SITE FOR RESIDUE SR 0 8983
011AD2SOFTWAREA 0:378 , G 0:379 , A 0:429 , HOH 0:5055 , HOH 0:7932BINDING SITE FOR RESIDUE SR 0 8984
012AD3SOFTWAREU 0:2663 , A 0:2811 , A 0:2812 , A 0:2816 , G 0:2817 , HOH 0:8430BINDING SITE FOR RESIDUE SR 0 8985
013AD4SOFTWAREC 0:1102 , C 0:1103 , HOH 0:3046 , GLU J:28BINDING SITE FOR RESIDUE SR 0 8986
014AD5SOFTWAREG 0:2700 , HOH 0:4065BINDING SITE FOR RESIDUE SR 0 8988
015AD6SOFTWAREA 0:2622 , G 0:2623 , HOH 0:6353BINDING SITE FOR RESIDUE SR 0 8989
016AD7SOFTWAREG 0:2617 , G 0:2618 , HOH 0:4123 , HOH 0:4314BINDING SITE FOR RESIDUE SR 0 8990
017AD8SOFTWAREA 0:1427 , HOH 0:8266BINDING SITE FOR RESIDUE SR 0 8991
018AD9SOFTWAREU 0:2277 , U 0:2278 , G 0:2471 , HOH 0:3092 , HOH 0:4248 , HOH 0:4256BINDING SITE FOR RESIDUE SR 0 8992
019BC1SOFTWAREG 0:877 , G 0:2623 , HOH 0:4138 , HOH 0:4151 , HOH 0:9519 , HOH A:9089BINDING SITE FOR RESIDUE MG 0 8009
020BC2SOFTWAREA 0:2101 , G 0:2102 , G 0:2537 , HOH 0:4156 , HOH 0:4656 , HOH 0:8269 , HOH 0:9531BINDING SITE FOR RESIDUE MG 0 8010
021BC3SOFTWAREA 0:844 , A 0:1689 , HOH 0:4117 , HOH 0:8303 , HOH 0:9504 , HOH 0:9522BINDING SITE FOR RESIDUE MG 0 8011
022BC4SOFTWAREG 0:456 , HOH 0:4435 , HOH 0:7845 , HOH 0:8279 , HOH 0:9915 , HOH C:8562BINDING SITE FOR RESIDUE MG 0 8012
023BC5SOFTWAREA 0:2011 , HOH 0:4643 , HOH 0:7691 , HOH 0:8298 , HOH 0:8299 , HOH 0:8300BINDING SITE FOR RESIDUE MG 0 8013
024BC6SOFTWAREC 0:1830 , HOH 0:8282 , HOH 0:8301 , HOH 0:9619 , HOH 0:9622 , HOH 0:9696BINDING SITE FOR RESIDUE MG 0 8014
025BC7SOFTWAREG 0:2304 , HOH 0:3467 , HOH 0:4134 , HOH 0:4135 , HOH 0:8285 , HOH 0:8286BINDING SITE FOR RESIDUE MG 0 8015
026BC8SOFTWAREG 0:2097 , U 0:2539 , G 0:2540 , HOH 0:4364 , HOH 0:8290 , HOH 0:9607 , HOH 0:9957BINDING SITE FOR RESIDUE MG 0 8016
027BC9SOFTWAREA 0:1381 , HOH 0:3438 , HOH 0:5602BINDING SITE FOR RESIDUE MG 0 8017
028BD1SOFTWAREGLY A:236BINDING SITE FOR RESIDUE SR 0 8993
029BD2SOFTWAREA 0:846 , G 0:1694BINDING SITE FOR RESIDUE SR 0 8994
030BD3SOFTWAREG 0:2609 , U 0:2610 , HOH 0:3800 , HOH 0:4194 , HOH 0:4217 , HOH 0:6083 , HOH 0:6228BINDING SITE FOR RESIDUE SR 0 8995
031BD4SOFTWAREU 0:1412 , A 0:1682 , HOH 0:7546BINDING SITE FOR RESIDUE SR 0 8996
032BD5SOFTWAREA 0:790 , A 0:791 , HOH 0:6203BINDING SITE FOR RESIDUE SR 0 8997
033BD6SOFTWAREG 0:834 , U 0:835 , HOH 0:4401BINDING SITE FOR RESIDUE SR 0 8998
034BD7SOFTWAREU 0:2461 , HOH 0:6713 , ASP 3:59BINDING SITE FOR RESIDUE SR 0 8999
035BD8SOFTWAREC 0:1536BINDING SITE FOR RESIDUE SR 0 9000
036BD9SOFTWAREC 0:2591 , HOH 0:6077 , HOH 0:6400BINDING SITE FOR RESIDUE SR 0 9001
037CC1SOFTWAREU 0:1120 , G 0:1121 , HOH 0:4661 , HOH 0:8306 , HOH 0:8307 , HOH 0:8372BINDING SITE FOR RESIDUE MG 0 8018
038CC2SOFTWAREC 0:2608 , G 0:2609 , U 0:2610 , HOH 0:8308 , HOH 0:8309 , HOH 0:8310 , HOH 0:9894BINDING SITE FOR RESIDUE MG 0 8019
039CC3SOFTWAREC 0:240 , G 0:269 , HOH 0:4367 , HOH 0:4508 , HOH 0:4648 , HOH 0:8373BINDING SITE FOR RESIDUE MG 0 8020
040CC4SOFTWAREA 0:1448 , U 0:1677 , HOH 0:4175 , HOH 0:4196 , HOH 0:4207 , HOH S:8993BINDING SITE FOR RESIDUE MG 0 8021
041CC5SOFTWAREU 0:1503 , A 0:1504 , C 0:1679 , HOH 0:8312 , HOH 0:8313 , HOH 0:8314BINDING SITE FOR RESIDUE MG 0 8022
042CC6SOFTWAREU 0:1748 , U 0:1749 , HOH 0:4136 , HOH 0:8280 , HOH 0:8281 , HOH 0:8291BINDING SITE FOR RESIDUE MG 0 8023
043CC7SOFTWAREU 0:777 , C 0:778 , HOH 0:3777 , HOH 0:8317 , SR 0:8934 , HOH 1:9002BINDING SITE FOR RESIDUE MG 0 8024
044CC8SOFTWAREU 0:2115 , HOH 0:3492 , HOH 0:4284 , HOH 0:4682 , ALA A:196 , HOH A:9015 , HOH A:9090BINDING SITE FOR RESIDUE MG 0 8025
045CC9SOFTWAREG 0:956 , HOH 0:4167 , HOH 0:8321 , HOH 0:8322 , HOH 0:8323 , HOH 0:9866BINDING SITE FOR RESIDUE MG 0 8026
046CD1SOFTWAREA 0:1317 , SER Y:207BINDING SITE FOR RESIDUE SR 0 9002
047CD2SOFTWAREG 0:2102 , A 0:2103BINDING SITE FOR RESIDUE SR 0 9004
048CD3SOFTWAREG 0:2639BINDING SITE FOR RESIDUE SR 0 9006
049CD4SOFTWAREG 0:1376 , A 0:1693 , HOH 0:4970BINDING SITE FOR RESIDUE SR 0 9007
050CD5SOFTWAREU 0:1368 , HOH 0:5359 , HOH R:8959 , HOH R:8960BINDING SITE FOR RESIDUE SR 0 9008
051CD6SOFTWAREA 9:56 , A 9:57 , HOH 9:9138BINDING SITE FOR RESIDUE MG 9 8074
052CD7SOFTWAREC 9:40BINDING SITE FOR RESIDUE NA 9 8543
053CD8SOFTWAREG 9:21 , G 9:22 , U 9:55 , A 9:57 , G 9:58 , C 9:59BINDING SITE FOR RESIDUE NA 9 8572
054CD9SOFTWAREG 9:78 , G 9:102BINDING SITE FOR RESIDUE SR 9 8980
055DC1SOFTWAREA 0:2553 , HOH 0:3637 , HOH 0:3713 , HOH 0:4145 , HOH 0:8377 , HOH 0:9574BINDING SITE FOR RESIDUE MG 0 8027
056DC2SOFTWAREHOH 0:4121 , HOH 0:4146 , HOH 0:4168 , HOH 0:4170 , HOH 0:8325 , HOH 0:9780BINDING SITE FOR RESIDUE MG 0 8028
057DC3SOFTWAREA 0:114 , U 0:115 , HOH 0:3413 , HOH 0:4458 , HOH 0:5579 , HOH 0:8326 , HOH 0:8327BINDING SITE FOR RESIDUE MG 0 8029
058DC4SOFTWAREU 0:392 , HOH 0:3193 , HOH 0:4285 , HOH 0:5133 , HOH 0:8379BINDING SITE FOR RESIDUE MG 0 8030
059DC5SOFTWAREC 0:195 , G 0:196 , A 0:227 , C 0:228 , HOH 0:4599 , HOH 0:4693 , HOH 0:5856BINDING SITE FOR RESIDUE MG 0 8031
060DC6SOFTWAREU 0:1309 , U 0:1346 , HOH 0:4154 , HOH 0:4910 , HOH 0:8328 , HOH 0:9937BINDING SITE FOR RESIDUE MG 0 8032
061DC7SOFTWAREG 0:816 , G 0:817 , HOH 0:3315 , HOH 0:7869 , MG 0:8083 , HOH 0:8381BINDING SITE FOR RESIDUE MG 0 8033
062DC8SOFTWAREC 0:2048 , C 0:2088 , A 0:2089 , HOH 0:3796 , GLY R:65 , HOH R:8999BINDING SITE FOR RESIDUE MG 0 8034
063DC9SOFTWAREG 0:1979 , HOH 0:8329 , HOH 0:8382 , HOH 0:8383 , HOH 0:8384BINDING SITE FOR RESIDUE MG 0 8035
064DD1SOFTWAREA 9:44 , HOH 9:9032 , HOH 9:9082 , HOH 9:9107BINDING SITE FOR RESIDUE SR 9 9003
065DD2SOFTWAREHOH 0:4462 , HOH A:8988 , HOH A:9002 , HOH A:9016 , HOH A:9063 , HOH A:9092BINDING SITE FOR RESIDUE MG A 8050
066DD3SOFTWAREG 0:1873 , HOH 0:4840 , ASP A:26 , LEU A:27 , GLU A:28 , ARG A:120BINDING SITE FOR RESIDUE MG A 8051
067DD4SOFTWARELYS A:178BINDING SITE FOR RESIDUE CL A 8809
068DD5SOFTWAREA 0:2633 , PHE A:201 , GLY A:202 , GLY A:203 , HIS A:208 , HOH A:9022 , HOH A:9095BINDING SITE FOR RESIDUE SR A 8929
069DD6SOFTWAREHOH 0:4840 , HOH 0:6411 , HOH 0:8420 , ASP A:26 , GLU A:28BINDING SITE FOR RESIDUE SR A 8930
070DD7SOFTWAREGLU A:28BINDING SITE FOR RESIDUE SR A 8977
071DD8SOFTWAREHOH 0:4253 , HOH 0:6886 , HOH 0:8236 , HOH B:9021 , HOH B:9135 , HOH B:9136BINDING SITE FOR RESIDUE MG B 8042
072DD9SOFTWAREHOH 0:3084 , ARG B:223 , LYS B:224 , HIS B:227BINDING SITE FOR RESIDUE CL B 8819
073EC1SOFTWAREG 0:1794 , HOH 0:7750 , HOH 0:8385 , HOH 0:8386BINDING SITE FOR RESIDUE MG 0 8036
074EC2SOFTWAREA 0:1098 , HOH 0:6743 , HOH 0:8400BINDING SITE FOR RESIDUE MG 0 8037
075EC3SOFTWAREC 0:2248 , HOH 0:7775BINDING SITE FOR RESIDUE MG 0 8038
076EC4SOFTWAREG 0:641 , A 0:1355 , HOH 0:4594 , HOH 0:8330 , HOH 0:8331BINDING SITE FOR RESIDUE MG 0 8039
077EC5SOFTWAREU 0:1125 , HOH 0:4119 , HOH 0:8404 , G 9:92 , HOH 9:9010 , HOH 9:9039BINDING SITE FOR RESIDUE MG 0 8040
078EC6SOFTWAREC 0:162 , U 0:2276 , HOH 0:8284 , HOH 0:8332 , HOH 0:8333 , HOH 0:9933BINDING SITE FOR RESIDUE MG 0 8041
079EC7SOFTWAREA 0:2757 , HOH 0:4165 , HOH 0:4467 , HOH 0:8351 , ASN B:335 , HOH B:9010BINDING SITE FOR RESIDUE MG 0 8043
080EC8SOFTWAREU 0:1883 , U 0:2012 , G 0:2013 , HOH 0:5492 , GLN A:207 , HOH A:9093BINDING SITE FOR RESIDUE MG 0 8044
081EC9SOFTWAREG 0:2013 , HOH 0:4259 , HOH 0:8334 , HOH 0:8335 , HOH A:9091 , HOH A:9093BINDING SITE FOR RESIDUE MG 0 8045
082ED1SOFTWAREHOH 0:3451 , HOH 0:3748 , ASN B:243 , SER B:245BINDING SITE FOR RESIDUE SR B 8950
083ED2SOFTWAREC 0:2672 , ARG B:25 , PHE B:26 , ARG B:310BINDING SITE FOR RESIDUE SR B 8987
084ED3SOFTWAREASP C:45 , THR C:94 , GLU C:95 , LYS C:96BINDING SITE FOR RESIDUE NA C 8503
085ED4SOFTWAREHOH 0:5583BINDING SITE FOR RESIDUE SR F 9005
086ED5SOFTWAREC 0:2287 , ARG H:117BINDING SITE FOR RESIDUE NA H 8518
087ED6SOFTWAREA 0:1133 , G 0:1134 , TYR H:157 , ILE H:160 , THR H:161 , PRO H:162BINDING SITE FOR RESIDUE SR H 8972
088ED7SOFTWAREHOH 0:6237 , HOH 0:9984 , ARG J:60 , VAL J:61 , ILE J:63 , TYR J:69BINDING SITE FOR RESIDUE NA J 8538
089ED8SOFTWAREILE J:127 , LYS J:128BINDING SITE FOR RESIDUE CL J 8801
090ED9SOFTWAREPRO J:88 , LYS J:90BINDING SITE FOR RESIDUE CL J 8802
091FC1SOFTWAREG 0:2618 , HOH 0:4218 , HOH 0:4545 , HOH 0:9536 , HOH 0:9540BINDING SITE FOR RESIDUE MG 0 8046
092FC2SOFTWAREG 0:175 , U 0:224 , G 0:393 , HOH 0:8336 , HOH 0:8337 , HOH 0:8338 , HOH 0:9668BINDING SITE FOR RESIDUE MG 0 8047
093FC3SOFTWAREA 0:1369 , U 0:2650 , HOH 0:3322 , HOH 0:8339 , HOH 0:8340 , HOH 0:8341BINDING SITE FOR RESIDUE MG 0 8048
094FC4SOFTWAREHOH 0:4673 , HOH 0:7468 , HOH 0:7885 , HOH 0:8277 , HOH 0:8350BINDING SITE FOR RESIDUE MG 0 8049
095FC5SOFTWAREA 0:1845 , U 0:1846 , G 0:1884 , HOH 0:8343 , ASN A:188 , ARG A:190BINDING SITE FOR RESIDUE MG 0 8052
096FC6SOFTWAREA 0:2568 , HOH 0:3235 , HOH 0:4247 , HOH 0:5309 , HOH 0:6694 , HOH 0:7134 , HOH 0:8406BINDING SITE FOR RESIDUE MG 0 8053
097FC7SOFTWAREA 0:166 , G 0:219 , HOH 0:4310 , HOH 0:5440 , HOH 0:6072 , HOH 0:9620BINDING SITE FOR RESIDUE MG 0 8055
098FC8SOFTWAREU 0:954 , C 0:2298 , HOH 0:4490 , HOH 0:7868 , HOH 0:8347 , HOH 0:8407BINDING SITE FOR RESIDUE MG 0 8056
099FC9SOFTWAREA 0:1286 , A 0:1287 , HOH 0:8344 , HOH 0:8345 , HOH 0:8408 , HOH W:7874BINDING SITE FOR RESIDUE MG 0 8058
100FD1SOFTWAREHOH 0:6237 , GLY J:64 , ASN J:65 , GLY J:68 , TYR J:69BINDING SITE FOR RESIDUE CL J 8821
101FD2SOFTWAREHOH 0:3919 , HOH 0:4731 , HOH 0:6519 , ASN K:42 , HOH K:2121 , HOH K:7871BINDING SITE FOR RESIDUE MG K 8054
102FD3SOFTWAREARG L:53BINDING SITE FOR RESIDUE CL L 8810
103FD4SOFTWARESER M:106 , PHE M:109 , PRO M:110 , LEU M:112 , HOH M:8924BINDING SITE FOR RESIDUE NA M 8539
104FD5SOFTWARESER M:106 , ARG M:113 , VAL M:114 , VAL M:159BINDING SITE FOR RESIDUE CL M 8818
105FD6SOFTWARELYS D:146 , ARG N:37 , LYS N:38 , ASN N:107BINDING SITE FOR RESIDUE CL N 8807
106FD7SOFTWAREHOH 0:6492 , HOH 0:6721 , HIS O:40BINDING SITE FOR RESIDUE CD O 8705
107FD8SOFTWAREHOH 0:7492 , ASN O:44BINDING SITE FOR RESIDUE CL O 8808
108FD9SOFTWAREASN Q:16 , ASP Q:20 , GLY Q:22 , SER Q:24 , SER Q:46 , HOH Q:1795 , HOH Q:5427BINDING SITE FOR RESIDUE NA Q 8540
109GC1SOFTWAREA 0:907 , A 0:908 , HOH 0:4133 , HOH 0:4408 , HOH 0:5418 , HOH 0:8346BINDING SITE FOR RESIDUE MG 0 8059
110GC2SOFTWAREHOH 0:7313 , HOH 0:8352 , HOH 0:8353 , HOH 0:8409 , HOH 0:8410 , HOH 2:7875BINDING SITE FOR RESIDUE MG 0 8060
111GC3SOFTWAREA 0:165 , A 0:167 , C 0:168 , HOH 0:4107 , HOH 0:4112 , HOH 0:4124BINDING SITE FOR RESIDUE MG 0 8061
112GC4SOFTWAREA 0:1684 , U 0:1724 , HOH 0:4697 , HOH 0:4981 , HOH 0:8356 , HOH 0:8413BINDING SITE FOR RESIDUE MG 0 8062
113GC5SOFTWAREC 0:1436 , A 0:1437 , HOH 0:5637 , HOH 0:5721 , HOH 0:8421BINDING SITE FOR RESIDUE MG 0 8063
114GC6SOFTWAREA 0:1754 , HOH 0:4204 , HOH 0:4644 , HOH 0:6828 , HOH 0:8357 , HOH 0:8414BINDING SITE FOR RESIDUE MG 0 8064
115GC7SOFTWAREA 0:1742 , HOH 0:3254 , HOH 0:4130 , HOH 0:8358 , HOH 0:9749 , HOH 0:9873BINDING SITE FOR RESIDUE MG 0 8065
116GC8SOFTWAREG 0:2617 , G 0:2618 , HOH 0:3104 , HOH 0:4283 , HOH 0:4848 , HOH 0:4974 , HOH 0:9536BINDING SITE FOR RESIDUE MG 0 8066
117GC9SOFTWAREG 0:2540 , G 0:2611 , HOH 0:3546 , HOH 0:4781 , NA 0:8534 , HOH 0:9561BINDING SITE FOR RESIDUE MG 0 8067
118GD1SOFTWARESER R:70 , VAL R:72 , HOH R:8928 , HOH R:8930 , HOH R:8964BINDING SITE FOR RESIDUE NA R 8532
119GD2SOFTWAREU 0:12 , LYS R:60 , GLN R:61 , ASN R:63 , SR R:8912BINDING SITE FOR RESIDUE NA R 8575
120GD3SOFTWAREHOH 0:9834 , LYS R:118BINDING SITE FOR RESIDUE CL R 8806
121GD4SOFTWAREGLN R:61 , ASN R:63 , NA R:8575BINDING SITE FOR RESIDUE SR R 8912
122GD5SOFTWAREHIS S:7 , GLU S:61 , HOH S:8973BINDING SITE FOR RESIDUE NA S 8510
123GD6SOFTWAREHOH 0:5796 , ASP S:59BINDING SITE FOR RESIDUE SR S 8961
124GD7SOFTWAREGLN T:37 , ARG T:111 , LEU T:112 , SER T:114 , ASP T:117 , HOH T:2868BINDING SITE FOR RESIDUE MG T 8057
125GD8SOFTWARECYS U:6 , CYS U:9 , CYS U:32 , CYS U:36BINDING SITE FOR RESIDUE CD U 8701
126GD9SOFTWAREHIS Y:133 , LYS Y:136 , LYS Y:137 , VAL Y:139 , HOH Y:8859 , HOH Y:8880 , HOH Y:8915BINDING SITE FOR RESIDUE MG Y 8086
127HC1SOFTWAREC 0:515 , A 0:516 , U 0:517 , G 0:518 , HOH 0:8361 , HOH 0:8415 , HOH 0:8416BINDING SITE FOR RESIDUE MG 0 8068
128HC2SOFTWAREA 0:2103 , U 0:2478 , HOH 0:4110 , HOH 0:4290 , HOH 0:6457BINDING SITE FOR RESIDUE MG 0 8069
129HC3SOFTWAREG 0:918 , C 0:2294 , HOH 0:3049 , HOH 0:3824 , HOH 0:6950 , HOH 0:8362 , HOH 0:9588BINDING SITE FOR RESIDUE MG 0 8070
130HC4SOFTWAREA 0:1843 , C 0:1844 , HOH 0:4141 , HOH 0:8417BINDING SITE FOR RESIDUE MG 0 8071
131HC5SOFTWAREA 0:1070 , G 0:1071 , HOH 0:3186 , HOH 0:4147 , HOH 0:4179 , HOH 0:4219BINDING SITE FOR RESIDUE MG 0 8072
132HC6SOFTWAREU 0:1096 , C 0:1257 , HOH 0:8363 , HOH 0:8418BINDING SITE FOR RESIDUE MG 0 8073
133HC7SOFTWAREG 0:1848 , G 0:1849 , HOH 0:4160 , HOH 0:4197 , HOH 0:4328 , HOH 0:4359BINDING SITE FOR RESIDUE MG 0 8075
134HC8SOFTWAREG 0:863 , U 0:864 , HOH 0:3840 , HOH 0:4169 , HOH 0:4173 , HOH 0:6033BINDING SITE FOR RESIDUE MG 0 8076
135HC9SOFTWAREA 0:907 , HOH 0:3444 , HOH 0:3868 , HOH 0:4181 , HOH 0:4243 , HOH Y:8867BINDING SITE FOR RESIDUE MG 0 8077
136HD1SOFTWAREG 0:1269 , HOH 0:5418 , ARG Y:169BINDING SITE FOR RESIDUE CL Y 8820
137HD2SOFTWARECYS Z:39 , CYS Z:42 , CYS Z:57 , CYS Z:60BINDING SITE FOR RESIDUE CD Z 8703
138HD3SOFTWARECYS 1:19 , CYS 1:22 , CYS 1:34 , CYS 1:37BINDING SITE FOR RESIDUE CD 1 8702
139HD4SOFTWAREU 0:862 , HOH 0:5368 , HOH 0:9666 , LYS 1:10 , ASN 1:12 , HOH 1:8990BINDING SITE FOR RESIDUE SR 1 8913
140HD5SOFTWAREHOH 0:3278 , HOH 0:3731 , HOH 0:4376 , HOH 0:9799 , ASP 1:47 , HOH 1:8976BINDING SITE FOR RESIDUE SR 1 8952
141HD6SOFTWARECYS 3:11 , CYS 3:14 , CYS 3:71 , CYS 3:74BINDING SITE FOR RESIDUE CD 3 8704
142HD7SOFTWAREASP 3:66BINDING SITE FOR RESIDUE CL 3 8804
143HD8SOFTWAREHOH 0:4450 , HOH 0:8411 , HOH 0:8412 , GLY 3:45 , GLY 3:47 , ASP 3:49BINDING SITE FOR RESIDUE SR 3 8932
144IC1SOFTWAREA 0:2612 , HOH 0:3515 , HOH 0:4164 , HOH 0:4176BINDING SITE FOR RESIDUE MG 0 8078
145IC2SOFTWAREU 0:2107 , C 0:2281 , U 0:2282 , HOH 0:4242 , HOH 0:5111 , HOH 0:7369BINDING SITE FOR RESIDUE MG 0 8079
146IC3SOFTWAREA 0:2434 , U 0:2458 , HOH 0:3395 , HOH 0:8426 , HOH 0:9752 , HOH 3:8950BINDING SITE FOR RESIDUE MG 0 8080
147IC4SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:8419BINDING SITE FOR RESIDUE MG 0 8081
148IC5SOFTWAREC 0:2104 , C 0:2105 , HOH 0:8274BINDING SITE FOR RESIDUE MG 0 8082
149IC6SOFTWAREG 0:817 , HOH 0:4096 , HOH 0:7864 , HOH 0:7869 , MG 0:8033 , HOH 0:8381 , HOH P:185BINDING SITE FOR RESIDUE MG 0 8083
150IC7SOFTWAREA 0:1106 , A 0:1107 , HOH 0:8390 , HOH 0:8391 , HOH 0:8392 , HOH 0:8393BINDING SITE FOR RESIDUE MG 0 8084
151IC8SOFTWAREHOH 0:6570 , HOH 0:7939 , HOH 0:8395 , HOH 0:8396 , HOH 0:8397BINDING SITE FOR RESIDUE MG 0 8085
152IC9SOFTWAREU 0:903 , A 0:1357 , HOH 0:3010 , HOH 0:4418 , HOH 0:5880 , HOH 0:6508BINDING SITE FOR RESIDUE MG 0 8087
153JC1SOFTWAREA 0:187 , HOH 0:3071 , HOH 0:4222 , HOH 0:4263 , HOH 0:9626 , HOH 0:9828BINDING SITE FOR RESIDUE MG 0 8088
154JC2SOFTWAREA 0:2112 , HOH 0:3092 , HOH 0:4248 , HOH 0:4416 , HOH 0:6602 , HOH 0:6868BINDING SITE FOR RESIDUE MG 0 8089
155JC3SOFTWAREA 0:2430 , HOH 0:4457 , HOH 0:5305 , HOH 0:9848 , HOH 0:9951BINDING SITE FOR RESIDUE MG 0 8090
156JC4SOFTWAREHOH 0:4774 , HOH 0:4790 , HOH 0:6878 , HOH 0:7066 , HOH 0:7197 , MG 0:8092 , HOH A:9019 , HOH A:9094BINDING SITE FOR RESIDUE MG 0 8091
157JC5SOFTWAREU 0:1850 , HOH 0:4160 , HOH 0:4186 , HOH 0:4359 , HOH 0:7197 , MG 0:8091 , HOH A:9019BINDING SITE FOR RESIDUE MG 0 8092
158JC6SOFTWAREA 0:1840 , C 0:1841 , A 0:2022 , HOH 0:5126 , HOH 0:7025 , HOH 0:9725BINDING SITE FOR RESIDUE MG 0 8093
159JC7SOFTWAREG 0:2102 , G 0:2482 , C 0:2536BINDING SITE FOR RESIDUE K 0 8401
160JC8SOFTWAREC 0:162 , U 0:163 , U 0:172 , HOH 0:9513 , HOH 0:9608 , ARG M:82BINDING SITE FOR RESIDUE K 0 8402
161JC9SOFTWAREC 0:1069 , G 0:1072 , G 0:1087 , HOH 0:3671 , HOH 0:3702 , HOH 0:5452BINDING SITE FOR RESIDUE NA 0 8501
162KC1SOFTWAREG 0:1119 , U 0:1120 , G 0:1121 , U 0:1122 , HOH 0:8307BINDING SITE FOR RESIDUE NA 0 8502
163KC2SOFTWAREA 0:630 , A 0:631 , A 0:2074 , HOH 0:4580 , HOH 0:5190 , HOH 0:6265BINDING SITE FOR RESIDUE NA 0 8504
164KC3SOFTWAREG 0:2092 , G 0:2093 , G 0:2094 , A 0:2649 , HOH 0:9624BINDING SITE FOR RESIDUE NA 0 8505
165KC4SOFTWAREC 0:40 , G 0:41 , A 0:442 , C 0:443BINDING SITE FOR RESIDUE NA 0 8506
166KC5SOFTWAREC 0:1394 , U 0:1432 , G 0:1433 , U 0:1724 , HOH 0:3909 , SR 0:8962BINDING SITE FOR RESIDUE NA 0 8507
167KC6SOFTWAREA 0:2577 , G 0:2578 , G 0:2579 , HOH 0:4993BINDING SITE FOR RESIDUE NA 0 8508
168KC7SOFTWAREG 0:2524 , G 0:2525 , HOH 0:4072 , HOH 0:5144BINDING SITE FOR RESIDUE NA 0 8509
169KC8SOFTWAREG 0:2399 , HOH 0:3455 , HOH 0:4329 , HOH 0:5552 , HOH 0:5599BINDING SITE FOR RESIDUE NA 0 8511
170KC9SOFTWAREU 0:2541 , U 0:2607 , HOH 0:3632 , HOH 0:9829 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8512
171LC1SOFTWAREA 0:165 , A 0:166 , A 0:167 , HOH 0:3189BINDING SITE FOR RESIDUE NA 0 8513
172LC2SOFTWAREC 0:896 , A 0:897 , HOH 0:6786 , HOH 0:8209BINDING SITE FOR RESIDUE NA 0 8514
173LC3SOFTWAREG 0:1416 , G 0:1417 , HOH 0:9775 , TRP 2:42 , ASN 2:45 , HOH 2:4135BINDING SITE FOR RESIDUE NA 0 8515
174LC4SOFTWAREG 0:2543 , G 0:2544 , HOH 0:3961 , HOH 0:4422 , HOH 0:7949 , NA 0:8517 , HOH 0:9711BINDING SITE FOR RESIDUE NA 0 8516
175LC5SOFTWAREG 0:2543 , G 0:2544 , G 0:2611 , U 0:2615 , HOH 0:3245 , NA 0:8516 , HOH 0:9583BINDING SITE FOR RESIDUE NA 0 8517
176LC6SOFTWAREG 0:885 , A 0:2112 , G 0:2113 , C 0:2475 , C 0:2476 , HOH 0:4968BINDING SITE FOR RESIDUE NA 0 8519
177LC7SOFTWAREC 0:130 , U 0:146 , G 0:147 , HOH 0:4620 , HOH 0:9994BINDING SITE FOR RESIDUE NA 0 8520
178LC8SOFTWAREA 0:776 , U 0:777 , U 0:779 , HOH 0:3127 , HOH 0:3777 , HOH 0:8186 , SR 0:8934BINDING SITE FOR RESIDUE NA 0 8521
179LC9SOFTWAREG 0:1971 , G 0:2009 , A 0:2010 , U 0:2012BINDING SITE FOR RESIDUE NA 0 8522
180MC1SOFTWAREU 0:821 , C 0:853 , G 0:854 , U 0:1831 , HOH 0:3231 , HOH 0:3707 , HOH 0:9535BINDING SITE FOR RESIDUE NA 0 8523
181MC2SOFTWAREG 0:56 , A 0:59 , A 0:60 , G 0:61 , HOH 0:5693 , HOH 0:6945BINDING SITE FOR RESIDUE NA 0 8524
182MC3SOFTWAREG 0:66 , U 0:107 , U 0:108 , HOH 0:7044BINDING SITE FOR RESIDUE NA 0 8525
183MC4SOFTWAREG 0:140 , C 0:141 , G 0:142 , HOH 0:9735BINDING SITE FOR RESIDUE NA 0 8526
184MC5SOFTWAREU 0:170 , C 0:171 , C 0:218 , G 0:221 , HOH 0:9798BINDING SITE FOR RESIDUE NA 0 8527
185MC6SOFTWAREG 0:386 , G 0:387 , G 0:388 , C 0:401 , U 0:402 , HOH 0:7534BINDING SITE FOR RESIDUE NA 0 8528
186MC7SOFTWAREC 0:1894 , A 0:1895 , G 0:1896 , U 0:1897 , HOH 0:5727 , HOH 0:8429BINDING SITE FOR RESIDUE NA 0 8529
187MC8SOFTWAREC 0:621 , G 0:622 , U 0:623 , 1MA 0:628 , A 0:630 , HOH 0:3375BINDING SITE FOR RESIDUE NA 0 8530
188MC9SOFTWAREG 0:1706 , G 0:1707 , HOH 0:3427 , HOH 0:5818 , HOH 0:7803 , HOH 0:8212BINDING SITE FOR RESIDUE NA 0 8531
189NC1SOFTWAREU 0:2659 , G 0:2660 , VAL R:72 , TRP R:75 , HOH R:8919 , HOH R:8930BINDING SITE FOR RESIDUE NA 0 8533
190NC2SOFTWAREG 0:2540 , G 0:2611 , G 0:2616 , U 0:2645 , HOH 0:3530 , HOH 0:4781 , MG 0:8067BINDING SITE FOR RESIDUE NA 0 8534
191NC3SOFTWAREU 0:1740 , U 0:1741 , G 0:2033 , HOH 0:3538 , HOH 0:6748BINDING SITE FOR RESIDUE NA 0 8535
192NC4SOFTWAREG 0:681 , A 0:682 , G 0:683 , HOH 0:8422BINDING SITE FOR RESIDUE NA 0 8536
193NC5SOFTWAREU 0:308 , U 0:335 , A 0:339 , C 0:342 , SER T:94 , ASN T:95 , HOH T:1124BINDING SITE FOR RESIDUE NA 0 8537
194NC6SOFTWAREA 0:914 , C 0:915 , C 0:1043 , C 0:1044 , G 0:1045BINDING SITE FOR RESIDUE NA 0 8541
195NC7SOFTWAREU 0:623 , U 0:624 , G 0:901 , HOH 0:7423BINDING SITE FOR RESIDUE NA 0 8542
196NC8SOFTWAREA 0:955 , HOH 0:7070 , C 9:81 , U 9:82BINDING SITE FOR RESIDUE NA 0 8544
197NC9SOFTWAREU 0:768 , C 0:769 , G 0:2111 , A 0:2112 , HOH 0:5306BINDING SITE FOR RESIDUE NA 0 8545
198OC1SOFTWAREG 0:1119 , C 0:1243 , HOH 0:5298 , THR J:47BINDING SITE FOR RESIDUE NA 0 8546
199OC2SOFTWAREC 0:920 , U 0:2278 , G 0:2279 , A 0:2463 , HOH 0:9954BINDING SITE FOR RESIDUE NA 0 8547
200OC3SOFTWAREG 0:941 , U 0:942 , G 0:1024 , HOH 0:6747BINDING SITE FOR RESIDUE NA 0 8548
201OC4SOFTWAREG 0:2611 , HOH 0:9985 , TRP B:242BINDING SITE FOR RESIDUE NA 0 8549
202OC5SOFTWAREG 0:898 , A 0:922 , A 0:923 , G 0:924 , U 0:2109 , HOH 0:6134BINDING SITE FOR RESIDUE NA 0 8550
203OC6SOFTWAREA 0:453 , U 0:454 , C 0:478 , G 0:479 , HOH 0:6433BINDING SITE FOR RESIDUE NA 0 8551
204OC7SOFTWAREU 0:837 , HOH 0:5079 , HOH 0:5388 , HOH 0:5578 , HOH 0:7792 , GLN B:230BINDING SITE FOR RESIDUE NA 0 8552
205OC8SOFTWAREA 0:167 , C 0:168 , G 0:2110 , G 0:2111 , U 0:2277 , HOH 0:5787BINDING SITE FOR RESIDUE NA 0 8553
206OC9SOFTWAREU 0:1359 , C 0:1360 , HOH 0:3974 , HOH 0:7507BINDING SITE FOR RESIDUE NA 0 8554
207PC1SOFTWAREU 0:2057 , G 0:2058 , HOH 0:3318BINDING SITE FOR RESIDUE NA 0 8555
208PC2SOFTWAREU 0:391 , U 0:392 , U 0:398 , C 0:399 , LYS M:193 , GLY M:194BINDING SITE FOR RESIDUE NA 0 8556
209PC3SOFTWAREG 0:544 , G 0:545 , G 0:610 , U 0:611 , HOH 0:3369 , HOH 0:3388 , HOH 0:4315 , HOH 0:4375BINDING SITE FOR RESIDUE NA 0 8557
210PC4SOFTWAREG 0:464 , G 0:475 , HOH 0:3332 , HOH 0:5092 , ARG C:55 , HOH C:8588BINDING SITE FOR RESIDUE NA 0 8558
211PC5SOFTWAREG 0:798 , G 0:814 , U 0:815BINDING SITE FOR RESIDUE NA 0 8559
212PC6SOFTWAREU 0:391 , U 0:392 , A 0:395 , U 0:398 , HOH 0:7038BINDING SITE FOR RESIDUE NA 0 8560
213PC7SOFTWAREG 0:1832 , A 0:2022 , HOH 0:4593 , HOH 0:9600BINDING SITE FOR RESIDUE NA 0 8561
214PC8SOFTWAREG 0:2491 , U 0:2492 , G 0:2529 , C 0:2530 , HOH 0:3128BINDING SITE FOR RESIDUE NA 0 8562
215PC9SOFTWAREU 0:919 , G 0:921 , G 0:924 , HOH 0:9771BINDING SITE FOR RESIDUE NA 0 8563
216QC1SOFTWAREG 0:1576 , U 0:1577 , G 0:1618 , G 0:1619 , C 0:1620 , HOH 0:4177 , HOH 0:7754BINDING SITE FOR RESIDUE NA 0 8564
217QC2SOFTWAREC 0:195 , G 0:196 , A 0:415 , G 0:416BINDING SITE FOR RESIDUE NA 0 8565
218QC3SOFTWAREG 0:868 , G 0:869 , A 0:886 , G 0:887 , HOH 0:9763BINDING SITE FOR RESIDUE NA 0 8566
219QC4SOFTWAREG 0:911 , U 0:1293 , A 0:1294 , G 0:1295 , HOH 0:6815BINDING SITE FOR RESIDUE NA 0 8567
220QC5SOFTWAREC 0:762 , G 0:902 , U 0:903 , HOH 0:3711 , HIS L:18 , HOH L:8826 , HOH L:8844BINDING SITE FOR RESIDUE NA 0 8568
221QC6SOFTWAREU 0:831 , U 0:832 , G 0:833 , HOH 0:4210 , HOH 0:4917BINDING SITE FOR RESIDUE NA 0 8569
222QC7SOFTWAREG 0:2585 , U 0:2586 , OMU 0:2587 , G 0:2592 , HOH 0:4188 , HOH 0:7536 , HOH 0:9827BINDING SITE FOR RESIDUE NA 0 8570
223QC8SOFTWAREG 0:2772 , G 0:2773BINDING SITE FOR RESIDUE NA 0 8571
224QC9SOFTWAREC 0:197 , HOH 0:5500 , HOH 0:5730 , HOH 0:7037BINDING SITE FOR RESIDUE NA 0 8573
225RC1SOFTWAREG 0:1077 , A 0:1079 , HOH 0:8205BINDING SITE FOR RESIDUE NA 0 8574
226RC2SOFTWAREG 0:1452 , G 0:1676 , LYS 2:2BINDING SITE FOR RESIDUE CL 0 8803
227RC3SOFTWAREC 0:197 , G 0:201 , G 0:229BINDING SITE FOR RESIDUE CL 0 8805
228RC4SOFTWAREC 0:2388 , HOH 0:3665 , PHE Q:52 , HIS Q:53BINDING SITE FOR RESIDUE CL 0 8811
229RC5SOFTWAREG 0:2582 , A 0:2596 , HOH 0:5576 , LYS K:14 , ILE K:32 , SER K:33BINDING SITE FOR RESIDUE CL 0 8812
230RC6SOFTWAREA 0:1328 , G 0:1329 , HOH 0:5149BINDING SITE FOR RESIDUE CL 0 8813
231RC7SOFTWAREG 0:644 , HIS L:13 , HOH L:8880BINDING SITE FOR RESIDUE CL 0 8814
232RC8SOFTWAREA 0:1597 , A 0:1598 , G 0:1646BINDING SITE FOR RESIDUE CL 0 8815
233RC9SOFTWAREG 0:1119 , C 0:1243 , LYS J:56BINDING SITE FOR RESIDUE CL 0 8816
234SC1SOFTWAREC 0:594 , U 0:595 , HOH Y:8853BINDING SITE FOR RESIDUE CL 0 8817
235SC2SOFTWAREG 0:1072 , G 0:1087 , A 0:1291BINDING SITE FOR RESIDUE CL 0 8822
236SC3SOFTWAREG 0:824 , G 0:854 , HOH 0:4451 , HOH 0:4779 , HOH 0:4913 , HOH 0:5018BINDING SITE FOR RESIDUE SR 0 8901
237SC4SOFTWAREG 0:836 , U 0:2615 , HOH 0:4333 , HOH 0:9861 , GLN B:230 , HOH B:8994BINDING SITE FOR RESIDUE SR 0 8902
238SC5SOFTWAREG 0:1489 , G 0:1491 , HOH 0:4128 , HOH 0:4449 , HOH 0:6644 , HOH 0:9897BINDING SITE FOR RESIDUE SR 0 8903
239SC6SOFTWAREA 0:643 , C 0:1353 , G 0:1354 , HOH 0:7047 , HOH 0:8432 , HOH 0:9931BINDING SITE FOR RESIDUE SR 0 8904
240SC7SOFTWAREA 0:1754 , A 0:1755 , HOH 0:7055 , HOH 0:7625 , HOH 0:8117BINDING SITE FOR RESIDUE SR 0 8905
241SC8SOFTWAREC 0:893 , HOH 0:6107 , HOH 0:8431 , HOH C:8547BINDING SITE FOR RESIDUE SR 0 8906
242SC9SOFTWAREG 0:1055 , HOH 0:4321 , HOH 0:5315 , HOH 0:6803 , ASP H:13 , HOH H:8991BINDING SITE FOR RESIDUE SR 0 8907
243TC1SOFTWAREU 0:146 , G 0:147 , G 0:182 , A 0:183 , ASP M:157 , HOH M:8939BINDING SITE FOR RESIDUE SR 0 8908
244TC2SOFTWAREHOH 0:4262 , HOH 0:4739 , HOH 0:5986 , HOH 0:6625 , HOH 0:7059 , HOH 0:7353BINDING SITE FOR RESIDUE SR 0 8909
245TC3SOFTWAREA 0:1747 , U 0:1748 , U 0:1749 , G 0:2585 , HOH 0:3179BINDING SITE FOR RESIDUE SR 0 8910
246TC4SOFTWAREC 0:85 , A 0:86 , C 0:87 , ASP T:68 , HOH T:4403BINDING SITE FOR RESIDUE SR 0 8911
247TC5SOFTWAREHOH 0:4642 , HOH 0:5364 , HOH 0:5697BINDING SITE FOR RESIDUE SR 0 8914
248TC6SOFTWAREU 0:664 , G 0:681 , HOH 0:7392 , HOH C:8540BINDING SITE FOR RESIDUE SR 0 8915
249TC7SOFTWAREC 0:1420 , C 0:1421 , G 0:1438 , HOH 0:6250BINDING SITE FOR RESIDUE SR 0 8916
250TC8SOFTWAREU 0:454 , C 0:478 , HOH 0:6127BINDING SITE FOR RESIDUE SR 0 8917
251TC9SOFTWAREA 0:1504 , A 0:1678 , C 0:1679 , HOH 0:4241 , HOH 0:8296 , HOH 0:8315BINDING SITE FOR RESIDUE SR 0 8918
252UC1SOFTWAREG 0:2543 , C 0:2608BINDING SITE FOR RESIDUE SR 0 8919
253UC2SOFTWAREG 0:2632 , HOH 0:5032BINDING SITE FOR RESIDUE SR 0 8920
254UC3SOFTWAREA 0:1717 , G 0:1718 , HOH 0:5042 , HOH 0:5822 , HOH 0:6855BINDING SITE FOR RESIDUE SR 0 8921
255UC4SOFTWAREG 0:471 , HOH 0:3542 , HOH 0:4889 , HOH 0:6097 , HOH 0:9702 , HOH 0:9742BINDING SITE FOR RESIDUE SR 0 8922
256UC5SOFTWAREG 0:1059 , C 0:1127 , HOH 0:4317 , HOH 0:5354 , HOH 0:5794 , HOH 0:9612BINDING SITE FOR RESIDUE SR 0 8923
257UC6SOFTWAREG 0:2725 , G 0:2755 , HOH 0:3216 , HOH 0:4308 , HOH 0:6813 , HOH 0:7138BINDING SITE FOR RESIDUE SR 0 8924
258UC7SOFTWAREG 0:503BINDING SITE FOR RESIDUE SR 0 8925
259UC8SOFTWAREHOH 0:3841 , HOH 0:6261 , HOH 0:6916BINDING SITE FOR RESIDUE SR 0 8926
260UC9SOFTWAREA 0:2553 , HOH 0:4145BINDING SITE FOR RESIDUE SR 0 8927
261VC1SOFTWAREU 0:1109 , G 0:1110 , A 0:1247 , HOH 0:3950 , HOH 0:7433BINDING SITE FOR RESIDUE SR 0 8928
262VC2SOFTWAREG 0:1543 , HOH 0:6557 , HOH 0:6569BINDING SITE FOR RESIDUE SR 0 8931
263VC3SOFTWAREA 0:532 , U 0:533 , HOH 0:4228 , HOH 0:4468 , HOH 0:8360BINDING SITE FOR RESIDUE SR 0 8933
264VC4SOFTWAREU 0:777 , C 0:778 , HOH 0:3777 , MG 0:8024 , HOH 0:8317 , NA 0:8521BINDING SITE FOR RESIDUE SR 0 8934
265VC5SOFTWAREG 0:2421 , U 0:2422 , C 0:2423 , HOH 0:8388 , HOH 0:8389BINDING SITE FOR RESIDUE SR 0 8935
266VC6SOFTWAREA 0:1291 , G 0:1292 , HOH 0:3723 , HOH 0:4109 , HOH 0:7912 , HOH 0:8369BINDING SITE FOR RESIDUE SR 0 8936
267VC7SOFTWAREHOH 0:4782 , HOH 0:6967 , HOH 0:7981BINDING SITE FOR RESIDUE SR 0 8937
268VC8SOFTWAREHOH 0:5499 , HOH 0:5661BINDING SITE FOR RESIDUE SR 0 8938
269VC9SOFTWAREG 0:84 , C 0:85 , ASP T:68 , HOH T:4403BINDING SITE FOR RESIDUE SR 0 8939
270WC1SOFTWAREA 0:2465 , G 0:2466 , HOH 0:4749 , HOH 0:8428 , ASP L:36BINDING SITE FOR RESIDUE SR 0 8940
271WC2SOFTWAREG 0:1683 , U 0:1696 , HOH 0:3288 , HOH 0:5246 , HOH 0:5326BINDING SITE FOR RESIDUE SR 0 8941
272WC3SOFTWAREA 0:2746 , U 0:2749 , G 0:2750 , HOH 0:6355 , HOH 0:8425BINDING SITE FOR RESIDUE SR 0 8942
273WC4SOFTWAREA 0:1885 , A 0:1886 , U 0:1887 , HOH 0:6593BINDING SITE FOR RESIDUE SR 0 8943
274WC5SOFTWAREU 0:2016 , HOH 0:8096BINDING SITE FOR RESIDUE SR 0 8944
275WC6SOFTWAREG 0:1484 , HOH 0:4212 , HOH 0:8319 , HOH 0:8320 , HOH 0:8375 , HOH 0:8376BINDING SITE FOR RESIDUE SR 0 8945
276WC7SOFTWAREG 0:2091 , HOH 0:6578BINDING SITE FOR RESIDUE SR 0 8946
277WC8SOFTWAREC 0:1690 , HOH 0:5196 , HOH 0:9946BINDING SITE FOR RESIDUE SR 0 8947
278WC9SOFTWAREA 0:2302 , A 0:2303 , HOH 0:4139 , HOH 0:4265 , HOH 0:5351 , HOH 0:8318BINDING SITE FOR RESIDUE SR 0 8948
279XC1SOFTWAREU 0:821 , C 0:822 , G 0:854 , HOH 0:3310 , HOH 0:4113 , HOH 0:4249BINDING SITE FOR RESIDUE SR 0 8949
280XC2SOFTWAREG 0:2696BINDING SITE FOR RESIDUE SR 0 8951
281XC3SOFTWAREU 0:391 , ARG 3:42 , HOH 3:8970BINDING SITE FOR RESIDUE SR 0 8953
282XC4SOFTWAREG 0:2810 , HOH 0:8126 , ASN B:27BINDING SITE FOR RESIDUE SR 0 8954
283XC5SOFTWAREU 0:2557 , HOH 0:3559 , HOH 0:7127BINDING SITE FOR RESIDUE SR 0 8955
284XC6SOFTWAREA 0:682 , G 0:683 , HOH 0:8422 , HOH 0:8434BINDING SITE FOR RESIDUE SR 0 8956
285XC7SOFTWAREC 0:1462 , U 0:1463 , GLY 1:40BINDING SITE FOR RESIDUE SR 0 8957
286XC8SOFTWAREA 0:1133 , G 0:1134 , HOH 0:5280 , HOH 0:9927BINDING SITE FOR RESIDUE SR 0 8958
287XC9SOFTWAREU 0:1972 , HOH 0:3172 , HOH 0:3803BINDING SITE FOR RESIDUE SR 0 8959
288YC1SOFTWAREG 0:1113 , HOH 0:4191BINDING SITE FOR RESIDUE SR 0 8960
289YC2SOFTWAREU 0:1432 , G 0:1433 , U 0:1724 , HOH 0:4086 , NA 0:8507BINDING SITE FOR RESIDUE SR 0 8962
290YC3SOFTWAREG 0:2284 , G 0:2285 , HOH 0:5998 , HOH 0:7661BINDING SITE FOR RESIDUE SR 0 8963
291YC4SOFTWAREG 0:2777 , HOH 0:4690BINDING SITE FOR RESIDUE SR 0 8964
292YC5SOFTWAREA 0:1815 , HOH 0:6526 , HOH 0:7873 , HOH 0:7998 , HOH 0:8348 , HOH 0:8349BINDING SITE FOR RESIDUE SR 0 8965
293YC6SOFTWAREC 0:235 , HOH 0:5191 , HOH 0:5929 , HOH 0:6626 , HOH 0:8050BINDING SITE FOR RESIDUE SR 0 8966
294YC7SOFTWAREU 0:2690 , HOH 0:3554 , HOH 0:6016BINDING SITE FOR RESIDUE SR 0 8967
295YC8SOFTWAREG 0:2522 , C 9:91 , HOH H:9012BINDING SITE FOR RESIDUE SR 0 8968
296YC9SOFTWAREA 0:1040 , G 0:1295 , A 0:1296 , HOH 0:5360 , HOH 0:9713 , GLY L:14 , HOH L:8881BINDING SITE FOR RESIDUE SR 0 8969
297ZC1SOFTWAREA 0:565 , G 0:592BINDING SITE FOR RESIDUE SR 0 8970
298ZC2SOFTWAREHOH 0:6920 , HOH 0:7755BINDING SITE FOR RESIDUE SR 0 8973
299ZC3SOFTWAREU 0:1835 , HOH 0:8130BINDING SITE FOR RESIDUE SR 0 8974
300ZC4SOFTWAREC 0:1894 , U 0:1897 , G 0:1898 , U 0:1939 , HOH 0:8429BINDING SITE FOR RESIDUE SR 0 8975
301ZC5SOFTWAREA 0:1375 , G 0:1726BINDING SITE FOR RESIDUE SR 0 8976
302ZC6SOFTWAREC 0:1129 , HOH 0:4119 , HOH 0:6573 , HOH 0:7381 , HOH 0:8404 , C 9:91 , G 9:92 , HOH 9:9071BINDING SITE FOR RESIDUE SR 0 8978
303ZC7SOFTWAREU 0:2640BINDING SITE FOR RESIDUE SR 0 8979
304ZC8SOFTWAREG 0:1290 , A 0:1291 , HOH 0:5445BINDING SITE FOR RESIDUE SR 0 8981
305ZC9SOFTWAREA 0:1746 , A 0:1747 , U 0:1748 , U 0:1749 , G 0:1752BINDING SITE FOR RESIDUE SR 0 8982

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YHQ)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:186 -Pro A:187
2Gly B:14 -Pro B:15
3Asn B:243 -Pro B:244
4Val C:136 -Pro C:137
5Gln F:55 -Pro F:56
6Arg M:184 -Pro M:185

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RL6_HALMA_001 *R3SRL6_HALMA  ---  ---ER2S
2UniProtVAR_RL6_HALMA_002 *E24SRL6_HALMA  ---  ---EE23S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (26, 26)

Asymmetric/Biological Unit (26, 26)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L37EPS01077 Ribosomal protein L37e signature.RL37_HALMA5-24  11:4-23
2RIBOSOMAL_L19EPS00526 Ribosomal protein L19e signature.RL19E_HALMA7-26  1P:6-25
3RIBOSOMAL_L24EPS01073 Ribosomal protein L24e signature.RL24E_HALMA9-26  1U:8-25
4RIBOSOMAL_L30PS00634 Ribosomal protein L30 signature.RL30_HALMA20-52  1W:20-52
5RIBOSOMAL_L39EPS00051 Ribosomal protein L39e signature.RL39_HALMA29-45  12:28-44
6RIBOSOMAL_L18EPS01106 Ribosomal protein L18e signature.RL18E_HALMA32-49  1O:31-48
7RIBOSOMAL_L21EPS01171 Ribosomal protein L21e signature.RL21_HALMA37-62  1Q:36-61
8RIBOSOMAL_L5PS00358 Ribosomal protein L5 signature.RL5_HALMA42-58  1D:41-57
9RIBOSOMAL_L29PS00579 Ribosomal protein L29 signature.RL29_HALMA43-57  1V:42-56
10RIBOSOMAL_L24PS01108 Ribosomal protein L24 signature.RL24_HALMA46-63  1T:45-62
11RIBOSOMAL_L15EPS01194 Ribosomal protein L15e signature.RL15E_HALMA48-71  1M:47-70
12RIBOSOMAL_L31EPS01144 Ribosomal protein L31e signature.RL31_HALMA49-63  1X:48-62
13RIBOSOMAL_L44EPS01172 Ribosomal protein L44e signature.RL44E_HALMA60-71  13:60-71
14RIBOSOMAL_L23PS00050 Ribosomal protein L23 signature.RL23_HALMA63-78  1S:62-77
15RIBOSOMAL_L7AEPS01082 Ribosomal protein L7Ae signature.RL7A_HALMA68-85  1F:67-84
16RIBOSOMAL_L14PS00049 Ribosomal protein L14 signature.RL14_HALMA71-97  1K:71-97
17RIBOSOMAL_L13PS00783 Ribosomal protein L13 signature.RL13_HALMA83-106  1J:83-106
18RIBOSOMAL_L1EPS00939 Ribosomal protein L1e signature.RL4_HALMA103-129  1C:103-129
19RIBOSOMAL_L15PS00475 Ribosomal protein L15 signature.RL15_HALMA108-138  1L:107-137
20RIBOSOMAL_L10EPS01257 Ribosomal protein L10e signature.RL10E_HALMA109-130  1H:114-130
21RIBOSOMAL_L11PS00359 Ribosomal protein L11 signature.RL11_HALMA122-137  1I:121-135
22RIBOSOMAL_L22PS00464 Ribosomal protein L22 signature.RL22_HALMA124-148  1R:123-147
23RIBOSOMAL_L32EPS00580 Ribosomal protein L32e signature.RL32_HALMA129-149  1Y:128-148
24RIBOSOMAL_L6_2PS00700 Ribosomal protein L6 signature 2.RL6_HALMA151-172  1E:150-171
25RIBOSOMAL_L2PS00467 Ribosomal protein L2 signature.RL2_HALMA188-199  1A:187-198
26RIBOSOMAL_L3PS00474 Ribosomal protein L3 signature.RL3_HALMA195-218  1B:194-217

(-) Exons   (0, 0)

(no "Exon" information available for 1YHQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 0 from PDB  Type:RNA  Length:2754
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                1yhq 0   10 UAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGaAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUugUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGuUuAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA 2914
                                    19        29        39        49        59        69        79        89        99       109       119     ||131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621      |631       641       651       661       671       681       691       701       711  ||   722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851      1861      1871      1881      1891      1901      1911      1921      1931      1941      1951|     1973      1983      1993      2003      2013      2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133  ||  2243      2253      2263      2273      2283      2293      2303      2313      2323      2333    ||2348      2358      2368      2378      2388      2398      2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618| |   2628      2638      2648      2658     |2670      2680      2690      2700      2710      2720      2730      2740      2750      2760      2770      2780      2790      2800      2810      2820      2830      2840      2850      2860      2870      2880      2890      2900      2910    
                                                                                                                                             125|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 628-1MA                                                                               714|                                                                                                                                                                                                                                                           970|                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1559|                                                                                                                                                                                                                                                                                                                                                                                                  1951|                                                                                                                                                                        2136|                                                                                                 2338|                                                                                                                                                                                                                                               2587-OMU                        2619-UR3                                     2664|                                                                                                                                                                                                                                                       
                                                                                                                                              128                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        716                                                                                                                                                                                                                                                            999                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             1561                                                                                                                                                                                                                                                                                                                                                                                                   1964                                                                                                                                                                         2237                                                                                                  2344                                                                                                                                                                                                                                                2588-OMG                         2621-PSU                                    2667                                                                                                                                                                                                                                                       

Chain 1 from PDB  Type:PROTEIN  Length:56
 aligned with RL37_HALMA | P32410 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:56
                                    11        21        31        41        51      
          RL37_HALMA      2 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   57
               SCOP domains d1yhq11 1:1-56 Ribosomal protein L37e                    SCOP domains
               CATH domains 1yhq100 1:1-56  [code=2.20.25.30, no name defined]       CATH domains
               Pfam domains -Ribosomal_L37e-1yhq101 1:2-56                           Pfam domains
         Sec.struct. author ...hhhhhh......eee......eeee....ee.............hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---RIBOSOMAL_L37E      --------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                1yhq 1    1 TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE   56
                                    10        20        30        40        50      

Chain 2 from PDB  Type:PROTEIN  Length:46
 aligned with RL39_HALMA | P22452 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:49
                                    11        21        31        41         
          RL39_HALMA      2 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE   50
               SCOP domains d1yhq21 2:1-49 Ribosomal protei   n L39e          SCOP domains
               CATH domains 1yhq200 2:1-49                                    CATH domains
               Pfam domains ------Ribosomal_L39-1yhq201 2:7   -49             Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...hhhhhhhh..---............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------RIBOSOMAL_L39E   ----- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1yhq 2    1 GKKSKATKKRLAKLDNQNSRVPAWVMLKTDR---RNHKRRHWRRNDTDE   49
                                    10        20        30|   |   40         
                                                         31  35              

Chain 3 from PDB  Type:PROTEIN  Length:92
 aligned with RL44E_HALMA | P32411 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:92
                                    10        20        30        40        50        60        70        80        90  
         RL44E_HALMA      1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
               SCOP domains d1yhq31 3:1-92 Ribosomal protein L44e                                                        SCOP domains
               CATH domains 1yhq300 3:1-92  [code=3.10.450.80, no name defined]                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeeeee....eeeeeeeee.........hhhhhhhhhhh....hhhhhh............eeeee.....ee..........eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------RIBOSOMAL_L4--------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                1yhq 3    1 MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE   92
                                    10        20        30        40        50        60        70        80        90  

Chain 9 from PDB  Type:RNA  Length:122
                                                                                                                                                           
                1yhq 9    1 UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC  122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with RL2_HALMA | P20276 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           RL2_HALMA      2 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  238
               SCOP domains d1yhqa2 A:1-90 N-terminal domain of ribosomal protein L2                                  d1yhqa1 A:91-237 C-terminal domain of ribosomal protein L2                                                                                          SCOP domains
               CATH domains 1yhqA01 A:1-78 Nucleic acid-binding proteins                                  ---1yhqA02 A:82-159  [code=2.30.30.30, no name defined]                          1yhqA03 A:160-237 Ribosomal protein L2, domain 3                               CATH domains
               Pfam domains ---------Ribosomal_L2-1yhqA02 A:10-82                                             -----Ribosomal_L2_C-1yhqA01 A:88-221                                                                                                       ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh.hhhhh...............eeeeeeeee......eeeeeee....eeee..........eee...........eee.hhh....eee...................eeeee.....eeee.....eeee....eeee......hhhhh...hhhhhhhhhh.........hhhhhhhhhh..............ee...........ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L2--------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq A    1 GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG  237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RL3_HALMA | P20279 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:337
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           RL3_HALMA      2 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  338
               SCOP domains d1yhqb1 B:1-337 Ribosomal protein L3                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1yhqB01 B:1-38,B:207-257              1yhqB02 B:39-77,B:189-206,B:258-337    1yhqB03 B:78-188  [code=3.30.1430.10, no name defined]                                                         1yhqB02           1yhqB01 B:1-38,B:207-257                           1yhqB02 B:39-77,B:189-206,B:258-337 Translation factors                          CATH domains
               Pfam domains --------------------------------------------Ribosomal_L3-1yhqB01 B:45-312                                                                                                                                                                                                                                               ------------------------- Pfam domains
         Sec.struct. author ....................................ee..eeeeeeeeeeeeee...........eeeeeeeeee...eeeeeeeeeeee..eeeeeeeee......hhhhh.......hhhhhhhhhhhhhhhh.eeeeeeeee.hhhhh.........eeeeeee..hhhhhhhhhhhhhhhh.eehhhhhh....eeeeeee..eeeeehhhhhhh....hhhhhhh........................eeee..eeeeeeeeeeeeeee................eeeeeee.........eeeeee.............eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L3            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq B    1 PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG  337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       

Chain C from PDB  Type:PROTEIN  Length:246
 aligned with RL4_HALMA | P12735 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           RL4_HALMA      1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
               SCOP domains d1yhqc1 C:1-246 Ribosomal protein L4                                                                                                                                                                                                                   SCOP domains
               CATH domains 1yhqC00 C:1-246  [code=3.40.1370.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------Ribosomal_L4-1yhqC01 C:16-246                                                                                                                                                                                                           Pfam domains
         Sec.struct. author .eeeee.....eeeeee.hhhhhh..hhhhhhhhhhhhhhhh.............................ee..ee.........................hhhhhhhhhhhhhhhh.hhhhhhhhh.........eee.hhhhhh.hhhhhhhhhhhh..hhhhhhh...ee..hhhhhhh..ee.....eeee....hhhhhh....eeee....hhhhhhhhhh....eeeehhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------RIBOSOMAL_L1E              --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq C    1 MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with RL5_HALMA | P14124 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:165
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           RL5_HALMA     11 FHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  175
               SCOP domains d1yhqd1 D:10-174 Rib     osomal protein L5                                                                                                                            SCOP domains
               CATH domains 1yhqD00 D:10-174  [c     ode=3.30.1440.10, no name defined]                                                                                                           CATH domains
               Pfam domains -Ribosomal_L5-1yhqD0     1 D:11-64                     ---Ribosomal_L5_C-1yhqD02 D:68-166                                                                    -------- Pfam domains
         Sec.struct. author .......eeeeeeeeee...-----..hhhhhhhhhh...eee.................eeeeee.hhhhhhhhhhhhhhh............eee.--------------------.eeeeeee..hhhhhh........hhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------RIBOSOMAL_L5     --------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq D   10 FHEMREPRIEKVVVHMGIGH-----ANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV  174
                                    19        29     |  39        49        59        69        79        89        99       | -         -       129       139       149       159       169     
                                              29    35                                                                     107                  128                                              

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with RL6_HALMA | P14135 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
           RL6_HALMA      2 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  173
               SCOP domains d1yhqe1 E:1-79 Ribosomal protein L6                                            d1yhqe2 E:80-172 Ribosomal protein L6                                                         SCOP domains
               CATH domains 1yhqE01 E:1-79  [code=3.90.930.12, no name defined]                            1yhqE02 E:80-172  [code=3.90.930.12, no name defined]                                         CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------Ribosomal_L6-1yhqE01 E:91-165                                              ------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------Ribosomal_L6-1yhqE02 E:91-165                                              ------- Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee..eeeeee..eeeeee......eeeee..eeeee....hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee......eeee...eeeeehhhhh...eeee.....eeeee..eeeeee.hhhhhhhhhhhhhhh.............eeeeee.. Sec.struct. author
                 SAPs(SNPs) -S--------------------S----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L6_2        - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq E    1 PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP  172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with RL7A_HALMA | P12743 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL7A_HALMA      2 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  120
               SCOP domains d1yhqf1 F:1-119 Ribosomal protein L7ae                                                                                  SCOP domains
               CATH domains 1yhqF00 F:1-119  [code=3.30.1330.30, no name defined]                                                                   CATH domains
               Pfam domains -------------Ribosomal_L7Ae-1yhqF01 F:14-108                                                                ----------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh.eeeehhhhhhhhhhhh....eeee.....hhhhhhhhhhhhh....eeee.hhhhhhhhh.......eeeee....hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------RIBOSOMAL_L7AE    ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq F    1 PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain G from PDB  Type:PROTEIN  Length:29
 aligned with RL10_HALMA | P15825 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:62
                                    21        31        41        51        61        71  
          RL10_HALMA     12 IPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDD   73
               SCOP domains d1yhqg1 G:12-73                                                SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh---------------------------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                1yhq G   12 IPEWKQEEVDAIVEMIES---------------------------------RNTLLERALDD   73
                                    21       | -         -         -         - |      71  
                                            29                                63          

Chain H from PDB  Type:PROTEIN  Length:160
 aligned with RL10E_HALMA | P60617 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:171
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 
         RL10E_HALMA      4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
               SCOP domains d1yhqh1 H:4-166 Ribosomal protein L10e                                                                                                                             -------- SCOP domains
               CATH domains 1yhqH00 H:4-174  [code=3.90.1170.10, no name defined]                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.........................eee..........eeeeeee...eeeehhhhhhhhhhhhhhhhhhhh.....eeee.....eeeee..-----------........eeeeeeeee....eeeeeeehhhhhhhhhhhhhhhh......eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------RIBOSOMAL_L10E        -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq H    4 KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENK-----------DGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL  174
                                    13        23        33        43        53        63        73        83        93        |-         -|      123       133       143       153       163       173 
                                                                                                                            102         114                                                            

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RL11_HALMA | P14122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:70
                                    76        86        96       106       116       126       136
          RL11_HALMA     67 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  136
               SCOP domains d1yhqi1 I:66-135 Ribosomal protein L11, C-terminal domain              SCOP domains
               CATH domains 1yhqI00 I:66-135  [code=1.10.10.250, no name defined]                  CATH domains
               Pfam domains Ribosomal_L11-1yhqI01 I:66-134                                       - Pfam domains
         Sec.struct. author ...hhhhhhhhhh..............eeehhhhhhhhhhhh.......hhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------RIBOSOMAL_L11   PROSITE (4)
                 Transcript ---------------------------------------------------------------------- Transcript
                1yhq I   66 GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE  135
                                    75        85        95       105       115       125       135

Chain J from PDB  Type:PROTEIN  Length:142
 aligned with RL13_HALMA | P29198 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:142
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  
          RL13_HALMA      4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
               SCOP domains d1yhqj1 J:4-145 Ribosomal protein L13                                                                                                          SCOP domains
               CATH domains 1yhqJ00 J:4-145  [code=3.90.1180.10, no name defined]                                                                                          CATH domains
               Pfam domains -----Ribosomal_L13-1yhqJ01 J:9-117                                                                                ---------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhhh...eeeehhhh.eee.hhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhheee.........................eeehhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------RIBOSOMAL_L13           --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq J    4 AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW  145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143  

Chain K from PDB  Type:PROTEIN  Length:132
 aligned with RL14_HALMA | P22450 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
          RL14_HALMA      1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
               SCOP domains d1yhqk1 K:1-132 Ribosomal protein L14                                                                                                SCOP domains
               CATH domains 1yhqK00 K:1-132 Ribosomal Protein L14;                                                                                               CATH domains
               Pfam domains ----------Ribosomal_L14-1yhqK01 K:11-132                                                                                             Pfam domains
         Sec.struct. author ......ee...ee...eeee.....eeeeeeeee...........ee....eeeeeeeee.......eeeeeeee....ee.....eeee...eeeee.............eeehhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------RIBOSOMAL_L14  PDB: K:71-97----------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq K    1 MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV  132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with RL15_HALMA | P12737 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL15_HALMA      2 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  151
               SCOP domains d1yhql1 L:1-150 Ribosomal protein L15 (L15p)                                                                                                           SCOP domains
               CATH domains 1yhqL01 L:1-50                                    1yhqL02 L:51-149  [code=3.100.10.     10, no name defined]                                         - CATH domains
               Pfam domains ---------------Ribosomal_L18e-1yhqL01 L:16-143                                                                                                 ------- Pfam domains
         Sec.struct. author ..hhhhh...............hhhhhh.........................hhhhh..eeeeehhhhhhh...........-----.eee.hhh........eeeee.........eeee.eehhhhhhhhhhh..eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------RIBOSOMAL_L15  PDB: L:107-137  ------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq L    1 TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAE-----FRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ  150
                                    10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150
                                                                                                             83    89                                                             

Chain M from PDB  Type:PROTEIN  Length:194
 aligned with RL15E_HALMA | P60618 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:194
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    
         RL15E_HALMA      2 ARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  195
               SCOP domains d1yhqm1 M:1-193 Ribosomal protein L15e                                                                                                                                                           - SCOP domains
               CATH domains 1yhqM00 M:1-194 Ribosomal protein l15e                                                                                                                                                             CATH domains
               Pfam domains --Ribosomal_L15e-1yhqM01 M:3-192                                                                                                                                                                -- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhh......eeeeeeeee.............hhhhh.........hhhhhhhhhhhhhh...eeeeeeeeee...eeeeeeeee...hhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------RIBOSOMAL_L15E          ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq M    1 ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG  194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain N from PDB  Type:PROTEIN  Length:186
 aligned with RL18_HALMA | P14123 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      
          RL18_HALMA      2 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  187
               SCOP domains d1yhqn1 N:1-186 Ribosomal protein L18 (L18p)                                                                                                                                               SCOP domains
               CATH domains 1yhqN00 N:1-186  [code=3.30.420.100, no name defined]                                                                                                                                      CATH domains
               Pfam domains --------Ribosomal_L18p-1yhqN01 N:9-129                                                                                           --------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...hhhhhhhhhh....eeeeee....eeeeeee......eeeeeee.hhhhhhh......hhhhhhhhhhhhhhhhhhh.....eee.........hhhhhhhhhhhhh......hhhhh.hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq N    1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL  186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain O from PDB  Type:PROTEIN  Length:115
 aligned with RL18E_HALMA | P12733 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:115
                                    11        21        31        41        51        61        71        81        91       101       111     
         RL18E_HALMA      2 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  116
               SCOP domains d1yhqo1 O:1-115 Ribosomal protein L18e                                                                              SCOP domains
               CATH domains 1yhqO00 O:1-115  [code=3.100.10.10, no name defined]                                                                CATH domains
               Pfam domains ---------------------Ribosomal_L18e-1yhqO01 O:22-99                                                ---------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhheeeehhhhhhhh....eeeeeeeee.........eeeeeeehhhhhhhhhhhheeeehhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------RIBOSOMAL_L18E    ------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq O    1 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR  115
                                    10        20        30        40        50        60        70        80        90       100       110     

Chain P from PDB  Type:PROTEIN  Length:143
 aligned with RL19E_HALMA | P14119 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
         RL19E_HALMA      2 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  144
               SCOP domains d1yhqp1 P:1-143 Ribosomal protein L19 (L19e)                                                                                                    SCOP domains
               CATH domains 1yhqP01 P:1-55  [code=1.10.1650.10, no name defined]   1yhqP02 P:56-88 Single Heli x bin1yhqP03 P:89-143  [code=1.10.1200.60, no name defined]  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh..hhh.eee...hhhhhhhh.hhhhhhhhhhh..eee.......hhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----RIBOSOMAL_L19E      ---------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq P    1 TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA  143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

Chain Q from PDB  Type:PROTEIN  Length:95
 aligned with RL21_HALMA | P12734 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RL21_HALMA      2 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   96
               SCOP domains d1yhqq1 Q:1-95 Ribosomal proteins L21e                                                          SCOP domains
               CATH domains 1yhqQ00 Q:1-95 Myosin S1 fragment SH3-like barrel                                               CATH domains
               Pfam domains Ribosomal_L21e-1yhqQ01 Q:1-95                                                                   Pfam domains
         Sec.struct. author ................hhhhh....hhhhh.......eeee...........hhhhh..eeeeeeee..eeeeeeee..eeeeeeehhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------RIBOSOMAL_L21E            ---------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1yhq Q    1 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE   95
                                    10        20        30        40        50        60        70        80        90     

Chain R from PDB  Type:PROTEIN  Length:150
 aligned with RL22_HALMA | P10970 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
          RL22_HALMA      2 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  151
               SCOP domains d1yhqr1 R:1-150 Ribosomal protein L22                                                                                                                  SCOP domains
               CATH domains 1yhqR00 R:1-150 Ribosomal Protein L22; Chain A                                                                                                         CATH domains
               Pfam domains ---------------Ribosomal_L22-1yhqR01 R:16-149                                                                                                        - Pfam domains
         Sec.struct. author ........hhh.eeeeeeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhh....ee...................ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhheeeeeeeeeeeee..eee.....eee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------RIBOSOMAL_L22            --- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1yhq R    1 GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain S from PDB  Type:PROTEIN  Length:81
 aligned with RL23_HALMA | P12732 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:81
                                    11        21        31        41        51        61        71        81 
          RL23_HALMA      2 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   82
               SCOP domains d1yhqs1 S:1-81 Ribosomal protein L23                                              SCOP domains
               CATH domains 1yhqS00 S:1-81  [code=3.30.70.330, no name defined]                               CATH domains
               Pfam domains -Ribosomal_L23-1yhqS01 S:2-81                                                     Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhheeeeee....hhhhhhhhhhhhhh..eeeeeeee.....eeeeeee....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------RIBOSOMAL_L23   ---- PROSITE (5)
                 Transcript --------------------------------------------------------------------------------- Transcript
                1yhq S    1 SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI   81
                                    10        20        30        40        50        60        70        80 

Chain T from PDB  Type:PROTEIN  Length:119
 aligned with RL24_HALMA | P10972 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          RL24_HALMA      2 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  120
               SCOP domains d1yhqt1 T:1-119 Ribosomal proteins L24 (L24p)                                                                           SCOP domains
               CATH domains 1yhqT00 T:1-119  [code=2.30.30.30, no name defined]                                                                     CATH domains
               Pfam domains -------------------------------------------KOW-1yhqT01 T:44-75             -------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhh.eeeehhhhhhhhh..eee.....eeee........eeeeeeee....eeee...eee.....eee...hhh.eeeee....hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------RIBOSOMAL_L24     --------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq T    1 SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA  119
                                    10        20        30        40        50        60        70        80        90       100       110         

Chain U from PDB  Type:PROTEIN  Length:53
 aligned with RL24E_HALMA | P14116 from UniProtKB/Swiss-Prot  Length:67

    Alignment length:53
                                    14        24        34        44        54   
         RL24E_HALMA      5 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   57
               SCOP domains d1yhqu1 U:4-56 Ribosomal protein L24e                 SCOP domains
               CATH domains 1yhqU00 U:4-56  [code=2.30.170.20, no name defined]   CATH domains
               Pfam domains Ribosomal_L24e-1yhqU01 U:4-56                         Pfam domains
         Sec.struct. author ...............eeee.....eeee.hhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----RIBOSOMAL_L24E    ------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------- Transcript
                1yhq U    4 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR   56
                                    13        23        33        43        53   

Chain V from PDB  Type:PROTEIN  Length:65
 aligned with RL29_HALMA | P10971 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:65
                                    11        21        31        41        51        61     
          RL29_HALMA      2 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   66
               SCOP domains d1yhqv1 V:1-65 Ribosomal protein L29 (L29p)                       SCOP domains
               CATH domains 1yhqV00 V:1-65  [code=1.10.287.310, no name defined]              CATH domains
               Pfam domains ----Ribosomal_L29-1yhqV01 V:5-63                               -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -----------------------------------------RIBOSOMAL_L29  --------- PROSITE (5)
                 Transcript ----------------------------------------------------------------- Transcript
                1yhq V    1 TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD   65
                                    10        20        30        40        50        60     

Chain W from PDB  Type:PROTEIN  Length:154
 aligned with RL30_HALMA | P14121 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
          RL30_HALMA      1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
               SCOP domains d1yhqw1 W:1-154 Archaeal L30 (L30a)                                                                                                                        SCOP domains
               CATH domains 1yhqW01 W:1-57,W:114-154                                 1yhqW02 W:58-113  [code=1.10.15.30, no name defined]    1yhqW01 W:1-57,W:114-154                  CATH domains
               Pfam domains Ribosomal_L30-1yhqW01 W:1-52                        ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......hhhhhhhhhhh......eeeee..hhhhhhhhhhhh..eeee..hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhh............eee.............hhhhh...ee.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------RIBOSOMAL_L30  PDB: W:20-52      ------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq W    1 MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR  154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

Chain X from PDB  Type:PROTEIN  Length:82
 aligned with RL31_HALMA | P18138 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:82
                                    17        27        37        47        57        67        77        87  
          RL31_HALMA      8 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   89
               SCOP domains d1yhqx1 X:7-88 Ribosomal protein L31e                                              SCOP domains
               CATH domains 1yhqX00 X:7-88  [code=3.10.440.10, no name defined]                                CATH domains
               Pfam domains Ribosomal_L31e-1yhqX01 X:7-87                                                    - Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.eeehhhhhhhhhh........eeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMAL_L31E -------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                1yhq X    7 ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAE   88
                                    16        26        36        46        56        66        76        86  

Chain Y from PDB  Type:PROTEIN  Length:142
 aligned with RL32_HALMA | P12736 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:142
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235  
          RL32_HALMA     96 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  237
               SCOP domains d1yhqy1 Y:95-236 Ribosomal protein L32e                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------Ribosomal_L32e-1yhqY01 Y:124-231                                                                            ----- Pfam domains
         Sec.struct. author .eeee..........hhhhhhhhhhhhhhh........................................hhhhh.............eeeee.hhhhhh......eeeee....hhhhhhhhhhhhhhh........eeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------RIBOSOMAL_L32E       ---------------------------------------------------------------------------------------- PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1yhq Y   95 TELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEV  236
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234  

Chain Z from PDB  Type:PROTEIN  Length:73
 aligned with RL37A_HALMA | P60619 from UniProtKB/Swiss-Prot  Length:92

    Alignment length:73
                                    19        29        39        49        59        69        79   
         RL37A_HALMA     10 SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
               SCOP domains d1yhqz1 Z:10-82 Ribosomal protein L37ae                                   SCOP domains
               CATH domains 1yhqZ00 Z:10-82  [code=2.20.25.30, no name defined]                       CATH domains
               Pfam domains -Ribosomal_L37ae-1yhqZ01 Z:11-82                                          Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhhhhhh.ee......eeeeeee..eeee.....eee.........hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                1yhq Z   10 RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS   82
                                    19        29        39        49        59        69        79   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (30, 31)

Asymmetric/Biological Unit
(-)
Fold: RL5-like (90)
(-)
Class: Peptides (792)

(-) CATH Domains  (32, 36)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
01a1yhqD00D:10-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
02a1yhqF00F:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
03a1yhqS00S:1-81
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
04a1yhqN00N:1-186
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
05a1yhqW01W:1-57,W:114-154
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
06a1yhqB03B:78-188
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
07a1yhqM00M:1-194
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
08a1yhqC00C:1-246
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
09a1yhqH00H:4-174
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
10a1yhqE01E:1-79
10b1yhqE02E:80-172
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
11a1yhqJ00J:4-145
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
12a1yhqR00R:1-150
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
13a1yhqO00O:1-115
13b1yhqL02L:51-149
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
14a1yhq3003:1-92
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
15a1yhqX00X:7-88
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
16a1yhqL01L:1-50
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
17a1yhqA03A:160-237
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
18a1yhqB01B:1-38,B:207-257
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
19a1yhqW02W:58-113
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
20a1yhqP01P:1-55
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
21a1yhqI00I:66-135
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
22a1yhq2002:1-49
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
23a1yhqV00V:1-65
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
24a1yhqP03P:89-143
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
25a1yhqP02P:56-88
(-)
Class: Mainly Beta (13760)
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
26a1yhqB02B:39-77,B:189-206,B:258-337
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
27a1yhqA01A:1-78
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
28a1yhqK00K:1-132
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
29a1yhqU00U:4-56
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
30a1yhqA02A:82-159
30b1yhqT00T:1-119
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
31a1yhqQ00Q:1-95
(-)
Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid:2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41.Haloarcula marismortui. Organism_taxid: 2238. Strain: dt41. Haloarculamarismortui. Organism_taxid: 2238. Strain: dt41. (2)
32a1yhq1001:1-56
32b1yhqZ00Z:10-82

(-) Pfam Domains  (26, 28)

Asymmetric/Biological Unit
(-)
Clan: KOW (56)
(-)
Clan: OB (224)
(-)
Clan: RRM (206)
(-)
Clan: Ribo_L29 (45)
(-)
Clan: S11_L18p (67)
(-)
Clan: TRASH (61)

(-) Gene Ontology  (23, 232)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (RL37_HALMA | P32410)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 2   (RL39_HALMA | P22452)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain 3   (RL44E_HALMA | P32411)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A   (RL2_HALMA | P20276)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B   (RL3_HALMA | P20279)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain C   (RL4_HALMA | P12735)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain D   (RL5_HALMA | P14124)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain E   (RL6_HALMA | P14135)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain F   (RL7A_HALMA | P12743)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain G   (RL10_HALMA | P15825)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RL10E_HALMA | P60617)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain I   (RL11_HALMA | P14122)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain J   (RL13_HALMA | P29198)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain K   (RL14_HALMA | P22450)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain L   (RL15_HALMA | P12737)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain M   (RL15E_HALMA | P60618)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain N   (RL18_HALMA | P14123)
molecular function
    GO:0008097    5S rRNA binding    Interacting selectively and non-covalently with 5S ribosomal RNA, the smallest RNA constituent of a ribosome.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain O   (RL18E_HALMA | P12733)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain P   (RL19E_HALMA | P14119)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Q   (RL21_HALMA | P12734)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain R   (RL22_HALMA | P10970)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain S   (RL23_HALMA | P12732)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain T   (RL24_HALMA | P10972)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain U   (RL24E_HALMA | P14116)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain V   (RL29_HALMA | P10971)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain W   (RL30_HALMA | P14121)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0015934    large ribosomal subunit    The larger of the two subunits of a ribosome. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site).
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain X   (RL31_HALMA | P18138)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Y   (RL32_HALMA | P12736)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain Z   (RL37A_HALMA | P60619)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0070180    large ribosomal subunit rRNA binding    Interacting selectively and non-covalently with the large ribosomal subunit RNA (LSU rRNA), a constituent of the large ribosomal subunit. In S. cerevisiae, this is the 25S rRNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1MA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PSU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UR3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg M:184 - Pro M:185   [ RasMol ]  
    Asn B:243 - Pro B:244   [ RasMol ]  
    Gln F:55 - Pro F:56   [ RasMol ]  
    Gly B:14 - Pro B:15   [ RasMol ]  
    Trp A:186 - Pro A:187   [ RasMol ]  
    Val C:136 - Pro C:137   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yhq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL10_HALMA | P15825
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL11_HALMA | P14122
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL13_HALMA | P29198
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL14_HALMA | P22450
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15E_HALMA | P60618
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL15_HALMA | P12737
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18E_HALMA | P12733
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL18_HALMA | P14123
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL19E_HALMA | P14119
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL21_HALMA | P12734
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL22_HALMA | P10970
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL23_HALMA | P12732
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24E_HALMA | P14116
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL24_HALMA | P10972
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL29_HALMA | P10971
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL2_HALMA | P20276
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL30_HALMA | P14121
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL31_HALMA | P18138
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL32_HALMA | P12736
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37A_HALMA | P60619
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL37_HALMA | P32410
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL39_HALMA | P22452
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL3_HALMA | P20279
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL44E_HALMA | P32411
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL4_HALMA | P12735
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL5_HALMA | P14124
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL6_HALMA | P14135
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RL7A_HALMA | P12743
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RL10E_HALMA | P60617
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL10_HALMA | P15825
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL11_HALMA | P14122
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL13_HALMA | P29198
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL14_HALMA | P22450
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15E_HALMA | P60618
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL15_HALMA | P12737
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18E_HALMA | P12733
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL18_HALMA | P14123
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL19E_HALMA | P14119
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL21_HALMA | P12734
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL22_HALMA | P10970
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL23_HALMA | P12732
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24E_HALMA | P14116
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL24_HALMA | P10972
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL29_HALMA | P10971
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL2_HALMA | P20276
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL30_HALMA | P14121
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL31_HALMA | P18138
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL32_HALMA | P12736
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37A_HALMA | P60619
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL37_HALMA | P32410
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL39_HALMA | P22452
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL3_HALMA | P20279
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL44E_HALMA | P32411
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL4_HALMA | P12735
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL5_HALMA | P14124
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL6_HALMA | P14135
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RL7A_HALMA | P12743
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL10E_HALMA | P60617: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL10_HALMA | P15825: 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 1zb4 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v9f
        RL11_HALMA | P14122: 1c04 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3g4s 3g6e 3g71 3i55 3i56 4v9f
        RL13_HALMA | P29198: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4v4r 4v4s 4v9f
        RL14_HALMA | P22450: 1c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL15E_HALMA | P60618: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL15_HALMA | P12737: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL18E_HALMA | P12733: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL18_HALMA | P14123: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL19E_HALMA | P14119: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL21_HALMA | P12734: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL22_HALMA | P10970: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL23_HALMA | P12732: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL24E_HALMA | P14116: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v42 4v4r 4v4s 4v4t 4v9f
        RL24_HALMA | P10972: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4t 4v9f
        RL29_HALMA | P10971: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL2_HALMA | P20276: 1c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL30_HALMA | P14121: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL31_HALMA | P18138: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL32_HALMA | P12736: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL37A_HALMA | P60619: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3g4s 3g6e 3g71 3i55 3i56 4adx 4v9f
        RL37_HALMA | P32410: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL39_HALMA | P22452: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL3_HALMA | P20279: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4t 4v9f
        RL44E_HALMA | P32411: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL4_HALMA | P12735: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1ml5 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4r 4v4s 4v4t 4v9f
        RL5_HALMA | P14124: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v4s 4v4t 4v9f
        RL6_HALMA | P14135: 1c04 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f
        RL7A_HALMA | P12743: 1ffk 1jj2 1k73 1k8a 1k9m 1kc8 1kd1 1kqs 1m1k 1m90 1n8r 1nji 1q7y 1q81 1q82 1q86 1qvf 1qvg 1s72 1vq4 1vq5 1vq6 1vq7 1vq8 1vq9 1vqk 1vql 1vqm 1vqn 1vqo 1vqp 1w2b 1yi2 1yij 1yit 1yj9 1yjn 1yjw 2otj 2otl 2qa4 2qex 3cc2 3cc4 3cc7 3cce 3ccj 3ccl 3ccm 3ccq 3ccr 3ccs 3ccu 3ccv 3cd6 3cma 3cme 3cpw 3cxc 3g4s 3g6e 3g71 3i55 3i56 3ow2 4adx 4v9f

(-) Related Entries Specified in the PDB File

1yi2 1yij