Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STABILIZED A2A ADENOSINE RECEPTOR A2AR-STAR2-BRIL IN COMPLEX WITH COMPOUND 12B AT 2.2A RESOLUTION
 
Authors :  E. Segala, D. Guo, R. K. Y. Cheng, A. Bortolato, F. Deflorian, A. S. Dore, J. C. Errey, L. H. Heitman, A. P. Ijzerman, F. H. Marshall, R. M. Cooke
Date :  17 Mar 16  (Deposition) - 29 Jun 16  (Release) - 27 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  G-Protein-Coupled Receptor, Integral Membrane Protein, Chimera, Thermostabilizing Mutations, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Segala, D. Guo, R. K. Cheng, A. Bortolato, F. Deflorian, A. S. Dore, J. C. Errey, L. H. Heitman, A. P. Ijzerman, F. H. Marshall, R. M. Cooke
Controlling The Dissociation Of Ligands From The Adenosine A2A Receptor Through Modulation Of Salt Bridge Strength.
J. Med. Chem. V. 59 6470 2016
PubMed-ID: 27312113  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00653

(-) Compounds

Molecule 1 - ADENOSINE RECEPTOR A2A,SOLUBLE CYTOCHROME B562,ADENOSINE RECEPTOR A2A
    Chains: A
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Cell Line: TNI PRO
    Expression System Common: CABBAGE LOOPER
    Expression System Plasmid: PFAST-BAC
    Expression System Taxid: 7111
    Expression System Vector Type: BACMID
    Gene: ADORA2A, ADORA2, CYBC
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS, ESCHERICHIA COLI
    Organism Taxid: 9606, 562
    Synonym: CYTOCHROME B-562

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 31)

Asymmetric/Biological Unit (5, 31)
No.NameCountTypeFull Name
16DX1Ligand/Ion2-(FURAN-2-YL)-N~5~-[3-(4-PHENYLPIPERAZIN-1-YL)PROPYL][1,2,4]TRIAZOLO[1,5-A][1,3,5]TRIAZINE-5,7-DIAMINE
2CLR4Ligand/IonCHOLESTEROL
3NA1Ligand/IonSODIUM ION
4OLA17Ligand/IonOLEIC ACID
5OLB8Ligand/Ion(2S)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE

(-) Sites  (30, 30)

Asymmetric Unit (30, 30)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:52 , SER A:91 , HOH A:2522 , HOH A:2577 , HOH A:2593binding site for residue NA A 2400
02AC2SOFTWARELEU A:85 , PHE A:168 , GLU A:169 , MET A:177 , TRP A:246 , LEU A:249 , HIS A:250 , ASN A:253 , HIS A:264 , ALA A:265 , LEU A:267 , MET A:270 , ILE A:274 , HOH A:2567 , HOH A:2585binding site for residue 6DX A 2401
03AC3SOFTWAREHIS A:75 , GLY A:76 , PHE A:79 , PHE A:133 , CLR A:2403 , OLA A:2417 , OLA A:2418 , OLB A:2423 , OLB A:2428binding site for residue CLR A 2402
04AC4SOFTWAREALA A:72 , ALA A:73 , GLY A:76 , ILE A:80 , CLR A:2402 , CLR A:2405 , OLB A:2424binding site for residue CLR A 2403
05AC5SOFTWAREPRO A:248 , CYS A:262 , SER A:263 , OLA A:2411binding site for residue CLR A 2404
06AC6SOFTWARELEU A:187 , PHE A:255 , PHE A:258 , CLR A:2403 , OLA A:2422 , OLB A:2424 , OLB A:2426 , OLB A:2427 , HOH A:2507binding site for residue CLR A 2405
07AC7SOFTWARETHR A:65 , PHE A:70 , OLB A:2427binding site for residue OLA A 2406
08AC8SOFTWAREPRO A:266binding site for residue OLA A 2407
09AC9SOFTWAREPHE A:44 , ALA A:97 , VAL A:116 , HOH A:2538binding site for residue OLA A 2408
10AD1SOFTWAREGLY A:5 , SER A:6 , LEU A:267 , TYR A:271 , VAL A:275 , OLA A:2419binding site for residue OLA A 2409
11AD2SOFTWARELEU A:96 , ILE A:127 , ILE A:135 , OLA A:2414 , OLB A:2430binding site for residue OLA A 2410
12AD3SOFTWARECLR A:2404binding site for residue OLA A 2411
13AD4SOFTWARELEU A:19 , LEU A:22 , TRP A:29 , PHE A:286 , HOH A:2560binding site for residue OLA A 2412
14AD5SOFTWAREOLA A:2419binding site for residue OLA A 2413
15AD6SOFTWAREARG A:120 , GLY A:123 , VAL A:130 , OLA A:2410binding site for residue OLA A 2414
16AD7SOFTWAREVAL A:25 , TRP A:32 , LYS A:233 , OLB A:2429binding site for residue OLA A 2415
17AD8SOFTWAREILE A:3 , SER A:7 , OLB A:2425binding site for residue OLA A 2416
18AD9SOFTWAREPHE A:133 , CLR A:2402 , OLA A:2418 , OLB A:2428binding site for residue OLA A 2417
19AE1SOFTWAREHIS A:75 , MET A:140 , CLR A:2402 , OLA A:2417 , OLB A:2430binding site for residue OLA A 2418
20AE2SOFTWARETHR A:279 , PHE A:286 , TYR A:290 , OLA A:2409 , OLA A:2413binding site for residue OLA A 2419
21AE3SOFTWARELEU A:244binding site for residue OLA A 2421
22AE4SOFTWAREALA A:236 , ALA A:239 , CLR A:2405binding site for residue OLA A 2422
23AE5SOFTWARETYR A:179 , PHE A:258 , CLR A:2402 , OLB A:2424 , OLB A:2430 , HOH A:2502 , HOH A:2518binding site for residue OLB A 2423
24AE6SOFTWARELEU A:187 , PHE A:258 , CLR A:2403 , CLR A:2405 , OLB A:2423 , HOH A:2507binding site for residue OLB A 2424
25AE7SOFTWARESER A:6 , SER A:67 , THR A:68 , OLA A:2416 , HOH A:2579binding site for residue OLB A 2425
26AE8SOFTWAREPHE A:255 , CYS A:262 , CLR A:2405 , OLB A:2427binding site for residue OLB A 2426
27AE9SOFTWAREPRO A:61 , THR A:65 , PHE A:70 , CYS A:71 , GLN A:163 , ASP A:261 , CLR A:2405 , OLA A:2406 , OLB A:2426binding site for residue OLB A 2427
28AF1SOFTWARETYR A:43 , GLY A:118 , ALA A:122 , TRP A:129 , CLR A:2402 , OLA A:2417 , OLB A:2429binding site for residue OLB A 2428
29AF2SOFTWARECYS A:28 , TRP A:32 , TYR A:43 , ARG A:205 , OLA A:2415 , OLB A:2428binding site for residue OLB A 2429
30AF3SOFTWAREHIS A:75 , MET A:140 , LEU A:141 , GLY A:142 , ASN A:175 , TYR A:179 , OLA A:2410 , OLA A:2418 , OLB A:2423binding site for residue OLB A 2430

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:71 -A:159
2A:74 -A:146
3A:77 -A:166
4A:259 -A:262

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5IUA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IUA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IUA)

(-) Exons   (0, 0)

(no "Exon" information available for 5IUA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:388
                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.....eee.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5iua A   -1 GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSH  306
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208|     1010      1020      1030      1040 ||   1066      1076      1086      1096      1106|      228       238       248       258       268       278       288       298        
                                                                                                                                                                                                                                           208|                                     1042|                                           1106|                                                                                       
                                                                                                                                                                                                                                           1001                                      1059                                             219
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IUA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IUA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IUA)

(-) Gene Ontology  (33, 33)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6DX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CLR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5iua)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5iua
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AA2AR_HUMAN | P29274
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  C562_ECOLX | P0ABE7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AA2AR_HUMAN | P29274
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  C562_ECOLX | P0ABE7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AA2AR_HUMAN | P29274: 1mmh 1upe 2ydo 2ydv 3eml 3pwh 3qak 3rey 3rfm 3uza 3uzc 3vg9 3vga 4eiy 4ug2 4uhr 5g53 5iu4 5iu7 5iu8 5iub 5jtb 5k2a 5k2b 5k2c 5k2d 5uig 5uvi
        C562_ECOLX | P0ABE7: 1apc 1lm3 1m6t 1qpu 1qq3 256b 2bc5 2qla 3c62 3c63 3de8 3de9 3foo 3fop 3hni 3hnj 3hnk 3hnl 3iq5 3iq6 3l1m 3m15 3m4b 3m4c 3m79 3nmi 3nmj 3nmk 3tol 3tom 3u8p 4ea3 4eiy 4iaq 4iar 4ib4 4je9 4jea 4jeb 4jkv 4l6r 4n6h 4nc3 4ntj 4o9r 4or2 4pxz 4py0 4qim 4qin 4rwa 4rwd 4u9d 4u9e 4yay 4z34 4z35 4z36 4zud 5awi 5bu7 5dhg 5dhh 5iu4 5iu7 5iu8 5iub 5jtb 5k2a 5k2b 5k2c 5k2d 5l31 5l32 5l7d 5l7i 5ndd 5ndz 5nj6 5tvn 5uen 5uig 5unf 5ung 5unh 5uvi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5IUA)