5AWI - JenaLib

Title :   DOMAIN-SWAPPED CYTOCHROME CB562 DIMER

Authors :   T. Miyamoto, M. Kuribayashi, S. Nagao, Y. Shomura, Y. Higuchi, S. Hirot

Date :   03 Jul 15 (Deposition) - 21 Oct 15 (Release) - 21 Oct 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym./Biol. Unit : A,B

Keywords :   Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Miyamoto, M. Kuribayashi, S. Nagao, Y. Shomura, Y. Higuchi, S. Hirota
Domain-Swapped Cytochrome Cb562 Dimer And Its Nanocage Encapsulating A Zn-So4 Cluster In The Internal Cavity
Chem Sci 2015
PubMed: search | Reference-DOI: 10.1039/C5SC02428E

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 12)

Sites (13, 13)

Asymmetric Unit (13, 13)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLU A:4 , PHE A:61 , PHE A:65 , CYS A:98 , CYS A:101 , HIS A:102 , TYR A:105 , ARG A:106 , HEM A:208 , HOH A:301 , HOH A:322 , GLU B:4 , MET B:7 , GLU B:8 , ASN B:11 , MET B:33 , PRO B:45 , PRO B:46	binding site for residue HEM A 201
02	AC2	SOFTWARE	ASP A:5 , SO4 A:206 , SO4 A:207 , ZN B:202 , SO4 B:204	binding site for residue ZN A 202
03	AC3	SOFTWARE	GLU A:8 , SO4 A:206 , ASP B:2 , GLU B:4 , ZN B:202	binding site for residue ZN A 203
04	AC4	SOFTWARE	ASP A:2 , SO4 A:207 , GLU B:4 , GLU B:8 , ZN B:202 , HOH B:301	binding site for residue ZN A 204
05	AC5	SOFTWARE	ALA A:1 , ASP A:12 , ASP A:39 , HOH A:308	binding site for residue ZN A 205
06	AC6	SOFTWARE	ASP A:5 , GLU A:8 , ZN A:202 , ZN A:203 , SO4 A:207 , HOH A:304 , ASP B:2 , GLU B:4 , ASP B:5 , ZN B:201 , ZN B:202 , SO4 B:204	binding site for residue SO4 A 206
07	AC7	SOFTWARE	ASP A:2 , ASP A:5 , ZN A:202 , ZN A:204 , SO4 A:206 , ALA B:1 , ASP B:2 , ASP B:5 , GLU B:8 , ZN B:201 , ZN B:202 , SO4 B:204 , HOH B:301	binding site for residue SO4 A 207
08	AC8	SOFTWARE	SO4 A:206 , SO4 A:207 , ASP B:5 , ZN B:202 , SO4 B:204	binding site for residue ZN B 201
09	AC9	SOFTWARE	ASP A:5 , ZN A:202 , ZN A:203 , ZN A:204 , SO4 A:206 , SO4 A:207 , GLU B:4 , ASP B:5 , ZN B:201 , HOH B:301	binding site for residue ZN B 202
10	AD1	SOFTWARE	ALA B:1 , GLU B:8 , ASP B:12 , ASP B:39 , HOH B:312	binding site for residue ZN B 203
11	AD2	SOFTWARE	ZN A:202 , SO4 A:206 , SO4 A:207 , ASP B:5 , ZN B:201	binding site for residue SO4 B 204
12	AD3	SOFTWARE	GLU A:4 , MET A:7 , GLU A:8 , MET A:33 , PRO A:46 , THR A:97 , CYS A:98 , ASN A:99 , ALA A:100 , HIS A:102 , GLN A:103 , LYS A:104 , TYR A:105 , HEM A:201 , HOH A:310 , GLU B:4 , PHE B:61 , GLY B:64 , PHE B:65 , THR B:97 , CYS B:98 , ASN B:99 , ALA B:100 , HIS B:102 , GLN B:103 , LYS B:104 , TYR B:105 , ARG B:106	binding site for Di-peptide HEM A 208 and CYS B 101
13	AD4	SOFTWARE	GLU A:4 , MET A:7 , GLU A:8 , MET A:33 , PRO A:46 , LEU A:94 , LYS A:95 , THR A:96 , THR A:97 , ASN A:99 , ALA A:100 , CYS A:101 , HIS A:102 , HEM A:201 , HOH A:310 , GLU B:4 , PHE B:61 , GLY B:64 , PHE B:65 , LEU B:94 , LYS B:95 , THR B:96 , THR B:97 , ASN B:99 , ALA B:100 , CYS B:101 , HIS B:102 , TYR B:105 , ARG B:106	binding site for Di-peptide HEM A 208 and CYS B 98

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:106
                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 5awi A   1 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR 106
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:106
                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 5awi B   1 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR 106
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5awi)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5awi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	C562_ECOLX \| P0ABE7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description