|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)
Asymmetric Unit (3, 8)
|
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3FOP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3FOP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3FOP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3FOP) |
Exons (0, 0)| (no "Exon" information available for 3FOP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:106 aligned with C562_ECOLX | P0ABE7 from UniProtKB/Swiss-Prot Length:128 Alignment length:106 32 42 52 62 72 82 92 102 112 122 C562_ECOLX 23 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR 128 SCOP domains d3fopa_ A: automated matches SCOP domains CATH domains 3fopA00 A:1-106 [code=1.20.120.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 3fop A 1 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR 106 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:106 aligned with C562_ECOLX | P0ABE7 from UniProtKB/Swiss-Prot Length:128 Alignment length:106 32 42 52 62 72 82 92 102 112 122 C562_ECOLX 23 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR 128 SCOP domains d3fopb_ B: automated matches SCOP domains CATH domains 3fopB00 B:1-106 [code=1.20.120.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 3fop B 1 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR 106 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3FOP) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (C562_ECOLX | P0ABE7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|