5IU4 - JenaLib

Title :   CRYSTAL STRUCTURE OF STABILIZED A2A ADENOSINE RECEPTOR A2AR-STAR2-BRIL IN COMPLEX WITH ZM241385 AT 1.7A RESOLUTION

Authors :   E. Segala, D. Guo, R. K. Y. Cheng, A. Bortolato, F. Deflorian, A. S. Dore, J. C. Errey, L. H. Heitman, A. P. Ijzerman, F. H. Marshall, R. M. Cooke

Date :   17 Mar 16 (Deposition) - 29 Jun 16 (Release) - 27 Jul 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.72

Chains :   Asym./Biol. Unit : A

Keywords :   G-Protein-Coupled Receptor, Integral Membrane Protein, Chimera, Thermostabilizing Mutations, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Segala, D. Guo, R. K. Cheng, A. Bortolato, F. Deflorian, A. S. Dore, J. C. Errey, L. H. Heitman, A. P. Ijzerman, F. H. Marshall, R. M. Cooke
Controlling The Dissociation Of Ligands From The Adenosine A2A Receptor Through Modulation Of Salt Bridge Strength.
J. Med. Chem. V. 59 6470 2016
PubMed-ID: 27312113 | Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00653

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (6, 31)

Sites (29, 29)

Asymmetric Unit (29, 29)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:52 , SER A:91 , HOH A:2546 , HOH A:2555 , HOH A:2612	binding site for residue NA A 2400
02	AC2	SOFTWARE	LEU A:85 , PHE A:168 , GLU A:169 , MET A:177 , TRP A:246 , LEU A:249 , HIS A:250 , ASN A:253 , MET A:270 , ILE A:274 , HOH A:2543 , HOH A:2598 , HOH A:2608 , HOH A:2611	binding site for residue ZMA A 2401
03	AC3	SOFTWARE	HIS A:75 , GLY A:76 , PHE A:79 , PHE A:133 , MET A:140 , CLR A:2403 , OLA A:2421 , OLA A:2422 , OLB A:2426	binding site for residue CLR A 2402
04	AC4	SOFTWARE	ALA A:72 , ALA A:73 , GLY A:76 , ILE A:80 , CLR A:2402 , CLR A:2405 , OLB A:2427 , OLC A:2429 , HOH A:2526	binding site for residue CLR A 2403
05	AC5	SOFTWARE	LEU A:247 , PRO A:248 , CYS A:262 , SER A:263 , OLA A:2412 , HOH A:2502 , HOH A:2614	binding site for residue CLR A 2404
06	AC6	SOFTWARE	CYS A:254 , PHE A:255 , PHE A:258 , CLR A:2403 , OLA A:2418 , OLB A:2427 , OLC A:2429 , HOH A:2589	binding site for residue CLR A 2405
07	AC7	SOFTWARE	THR A:65 , OLA A:2423 , OLC A:2429	binding site for residue OLA A 2406
08	AC8	SOFTWARE	PRO A:266	binding site for residue OLA A 2407
09	AC9	SOFTWARE	LEU A:244	binding site for residue OLA A 2408
10	AD1	SOFTWARE	PHE A:44 , ALA A:97 , VAL A:116 , HOH A:2583	binding site for residue OLA A 2409
11	AD2	SOFTWARE	GLY A:5 , LEU A:267 , TYR A:271 , VAL A:275 , HOH A:2637	binding site for residue OLA A 2410
12	AD3	SOFTWARE	LEU A:96 , ILE A:127 , LEU A:131 , CYS A:185 , PRO A:189 , OLA A:2415 , OLA A:2420	binding site for residue OLA A 2411
13	AD4	SOFTWARE	CLR A:2404	binding site for residue OLA A 2412
14	AD5	SOFTWARE	LEU A:19 , LEU A:26 , TRP A:29 , PHE A:286	binding site for residue OLA A 2413
15	AD6	SOFTWARE	GLY A:123 , VAL A:130 , OLA A:2411	binding site for residue OLA A 2415
16	AD7	SOFTWARE	OLA A:2425	binding site for residue OLA A 2416
17	AD8	SOFTWARE	TRP A:32 , LYS A:233 , OLB A:2428	binding site for residue OLA A 2417
18	AD9	SOFTWARE	LEU A:187 , LEU A:194 , ALA A:236 , ALA A:243 , CLR A:2405	binding site for residue OLA A 2418
19	AE1	SOFTWARE	MET A:140 , LEU A:141 , TYR A:179 , ALA A:184 , OLA A:2411 , OLA A:2421 , OLB A:2426 , HOH A:2508 , HOH A:2515	binding site for residue OLA A 2420
20	AE2	SOFTWARE	MET A:140 , CLR A:2402 , OLA A:2420 , OLA A:2422 , HOH A:2503	binding site for residue OLA A 2421
21	AE3	SOFTWARE	CLR A:2402 , OLA A:2421 , OLC A:2430	binding site for residue OLA A 2422
22	AE4	SOFTWARE	PHE A:255 , CYS A:262 , OLA A:2406 , OLC A:2429 , HOH A:2502 , HOH A:2588	binding site for residue OLA A 2423
23	AE5	SOFTWARE	SER A:6 , HOH A:2513	binding site for residue OLA A 2424
24	AE6	SOFTWARE	THR A:279 , OLA A:2416	binding site for residue OLA A 2425
25	AE7	SOFTWARE	TYR A:179 , PHE A:258 , CLR A:2402 , OLA A:2420 , OLB A:2427 , HOH A:2564	binding site for residue OLB A 2426
26	AE8	SOFTWARE	PHE A:183 , PHE A:258 , CLR A:2403 , CLR A:2405 , OLB A:2426 , HOH A:2505 , HOH A:2526 , HOH A:2589 , HOH A:2624	binding site for residue OLB A 2427
27	AE9	SOFTWARE	CYS A:28 , TYR A:43 , LEU A:54 , ARG A:205 , OLA A:2417	binding site for residue OLB A 2428
28	AF1	SOFTWARE	LEU A:58 , PHE A:62 , THR A:65 , PHE A:70 , CYS A:71 , CLR A:2403 , CLR A:2405 , OLA A:2406 , OLA A:2423 , HOH A:2617	binding site for residue OLC A 2429
29	AF2	SOFTWARE	TYR A:43 , LEU A:54 , GLY A:118 , ILE A:125 , TRP A:129 , PHE A:133 , OLA A:2422	binding site for residue OLC A 2430

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:388
                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.....eee.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5iu4 A   -1 GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS  305
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208|     1010      1020      1030      1040 ||   1065      1075      1085      1095      1105||     227       237       247       257       267       277       287       297        
                                                                                                                                                                                                                                           208|                                     1042|                                            1106|                                                                                      
                                                                                                                                                                                                                                           1001                                      1058                                              219

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (33, 33)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CLR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OLA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OLB	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OLC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZMA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]
		AF2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5iu4)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5iu4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AA2AR_HUMAN \| P29274
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	C562_ECOLX \| P0ABE7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description