Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE HUMAN INSULIN RECEPTOR ECTODOMAIN, IRDELTABETA CONSTRUCT, IN COMPLEX WITH FOUR FAB MOLECULES
 
Authors :  T. Croll, B. J. Smith, M. B. Margetts, J. Whittaker, M. A. Weiss, C. W. War M. C. Lawrence
Date :  20 May 15  (Deposition) - 24 Feb 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.30
Chains :  Asym. Unit :  A,B,C,D,E
Biol. Unit 1:  A,B,C,D,E  (2x)
Keywords :  Receptor Tyrosine Kinase Extracellular Domain Antibody Fragments, Hormone Receptor-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. I. Croll, B. J. Smith, M. B. Margetts, J. Whittaker, M. A. Weiss, C. W. Ward, M. C. Lawrence
Higher-Resolution Structure Of The Human Insulin Receptor Ectodomain: Multi-Modal Inclusion Of The Insert Domain.
Structure V. 24 469 2016
PubMed-ID: 26853939  |  Reference-DOI: 10.1016/J.STR.2015.12.014

(-) Compounds

Molecule 1 - FAB 83-7 HEAVY CHAIN
    Chains: A
    Engineered: YES
    Expression System: MUS MUSCULUS
    Expression System Taxid: 10090
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 2 - FAB 83-7 LIGHT CHAIN
    Chains: B
    Engineered: YES
    Expression System: MUS MUSCULUS
    Expression System Taxid: 10090
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 3 - FAB 83-14 HEAVY CHAIN
    Chains: C
    Engineered: YES
    Expression System: MUS MUSCULUS
    Expression System Taxid: 10090
    Gene: IGH-1A
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 4 - FAB 83-14 LIGHT CHAIN
    Chains: D
    Engineered: YES
    Expression System: MUS MUSCULUS
    Expression System Taxid: 10090
    Gene: IGKC, IGK-C
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 5 - INSULIN RECEPTOR
    Chains: E
    Engineered: YES
    Expression System: CRICETULUS GRISEUS
    Expression System Cell Line: LEC8
    Expression System Plasmid: PEE14
    Expression System Taxid: 10029
    Expression System Vector Type: GLUTAMINE SYNTHASE
    Mutation: YES
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit : ABCDE
Biological Unit 1 (2x): ABCDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 25)

Asymmetric Unit (4, 25)
No.NameCountTypeFull Name
1BMA2Ligand/IonBETA-D-MANNOSE
2FUC6Ligand/IonALPHA-L-FUCOSE
3MAN1Ligand/IonALPHA-D-MANNOSE
4NAG16Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (4, 50)
No.NameCountTypeFull Name
1BMA4Ligand/IonBETA-D-MANNOSE
2FUC12Ligand/IonALPHA-L-FUCOSE
3MAN2Ligand/IonALPHA-D-MANNOSE
4NAG32Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN E:16binding site for Mono-Saccharide NAG E 1001 bound to ASN E 16
02AC2SOFTWAREGLU E:6 , GLU E:22 , GLU E:24 , ASN E:25binding site for Poly-Saccharide residues NAG E 1002 through FUC E 1004 bound to ASN E 25
03AC3SOFTWAREASN E:111 , THR E:113 , SER E:134 , ARG E:135 , ILE E:136 , LEU E:137 , ASP E:138 , SER E:198 , LEU E:213 , ARG E:229binding site for Poly-Saccharide residues NAG E 1005 through BMA E 1007 bound to ASN E 111
04AC4SOFTWAREASN E:108 , MET E:110 , LYS E:190 , ASN E:215binding site for Mono-Saccharide NAG E 1008 bound to ASN E 215
05AC5SOFTWAREASP A:54 , ASN A:56 , ARG E:252 , ASN E:255 , PHE E:258binding site for Poly-Saccharide residues NAG E 1009 through FUC E 1011 bound to ASN E 255
06AC6SOFTWARELYS C:205 , ASP C:207 , LYS C:208 , GLU D:123 , ASN E:397binding site for Poly-Saccharide residues NAG E 1012 through FUC E 1017 bound to ASN E 397
07AC7SOFTWAREASN E:418 , THR E:420binding site for Poly-Saccharide residues NAG E 1018 through FUC E 1019 bound to ASN E 418
08AC8SOFTWAREASN E:514binding site for Mono-Saccharide NAG E 1020 bound to ASN E 514
09AC9SOFTWAREASN E:606 , VAL E:769 , SER E:771binding site for Poly-Saccharide residues NAG E 1021 through FUC E 1023 bound to ASN E 606
10AD1SOFTWAREASN E:881 , TYR E:902binding site for Poly-Saccharide residues NAG E 1024 through FUC E 1025 bound to ASN E 881

(-) SS Bonds  (25, 25)

Asymmetric Unit
No.Residues
1A:22 -A:95
2A:145 -A:200
3B:23 -B:94
4B:139 -B:199
5C:22 -C:96
6C:140 -C:195
7D:23 -D:88
8E:8 -E:26
9E:126 -E:155
10E:159 -E:182
11E:169 -E:188
12E:192 -E:201
13E:196 -E:207
14E:208 -E:216
15E:212 -E:225
16E:228 -E:237
17E:241 -E:253
18E:259 -E:284
19E:266 -E:274
20E:288 -E:301
21E:304 -E:308
22E:312 -E:333
23E:435 -E:468
24E:647 -E:860
25E:786 -E:795

(-) Cis Peptide Bonds  (11, 11)

Asymmetric Unit
No.Residues
1Phe A:151 -Pro A:152
2Glu A:153 -Pro A:154
3Trp A:193 -Pro A:194
4Ser B:7 -Pro B:8
5Tyr B:145 -Pro B:146
6Gly C:8 -Pro C:9
7Phe C:146 -Pro C:147
8Glu C:148 -Pro C:149
9Ser D:7 -Pro D:8
10Tyr D:140 -Pro D:141
11Pro E:243 -Pro E:244

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZXB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZXB)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZXB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee.......eeeeeee......eeeeee.....eee..hhhh.eeeeee....eeeeee...hhhhheeeeeeee.............eeeee........eeeee.....eeeeeeeeeee.....eeee.hhh....eee...ee....eeeeeeeeee.hhh.....eeeeeehhhheeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxb A   1 QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD 219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  ||   145       155       165       175       185       195       205       215    
                                                                                                                                                              133|                                                                                
                                                                                                                                                               139                                                                                


Chain B from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee.............eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee.....ee...eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhhh..eeeeeeee..eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxb B   1 DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE 218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        


Chain C from PDB  Type:PROTEIN  Length:187
                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeeehhh.eeeeee....eeeeeee...ee...eeeee........eeeee...eeeeeeeeee.....eeee.hhh....eee...eee..eeeeeeeeee.eeeeehhhheeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxb C   1 QVQLQQSGPELVKPGALVKISCKASGYTFTNYDIHWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADKSSSTAYMHLSEKSAVYFCAREWAYWGQGTLVTVSAAKTTAPSVYPLAPSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTCNVAHPASSTKVDKK 209
                                    10        20        30        40        50        60        70        80   ||   94       104       114       124 ||    142       152       162       172       182||     202       
                                                                                                              84|                                  126|                                             183|               
                                                                                                               89                                   135                                              194               


Chain D from PDB  Type:PROTEIN  Length:182
                                                                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee.......eeeeee.....eeeeee...ee.......eeeeee..eeeeee...hhhhh.eeeeee......ee...eeeee.......eeeee..hhhhhhhh....eeeeeee.........eeee.........eeeeee............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxb D   1 DIQMTQSPSSLSASLGERVSLTCRASQDIGGNLYWLQQGPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKVLNSWTDQDSKDSTYSMSSTLATHKTSTSPIVKSF 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      |161       171       197       207  
                                                                                                                                                                            147|                 179|             
                                                                                                                                                                             159                  196             


Chain E from PDB  Type:PROTEIN  Length:800
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeee..hhhhhhhh.eeeeeeeeeeeee...hhhhhh........ee...eeeeee..............ee........eeeeee..............ee...eeeee...........hhhhh.......eee.hhhhh.............ee..ee.eee..ee....hhhhh.................................eee..eee.......eee...eeehhhhhhhhhhhhh....eee..eee......eee......eee.......eeeeeeeeeee.hhhhhhh.....eeeeeeee........hhhhhhhhh...ee...eeee...............ee.........eeeeee................ee...eeeee.....hhhhhhhhhhhh........................eee.eeeeee....eeeee......hhh.eeeeeeeeee.......eee...............eeee.......eeeeeeeeee..........eee..eeee.........eeeeee......eeeeee..........eeeee......hhhhhh..............hhhhhhhhhhhhhhh......eeeee...eeee.......eeeeeeeeeee.....ee...eeeeee..............eeee.....eeee..........eeeeeeeeee.....eeeeeehhhhhhhh.eee.....eeeeeeeeeee..........eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxb E   1 HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTNCPATQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRKELEESSFRKTFEDYLHEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLD 910
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 ||   |179       189       199       209       219       229       239       249       259       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515|      540       550       560       570       580       590       600       610       620       630       640       650     ||697       707  ||   760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910
                                                                                                                                                                                           162| 172|                                                                                       267|                                                                                                                                                                                                                                              515|                                                                                                                          656|             710|                                                                                                                                                            
                                                                                                                                                                                            168  177                                                                                        274                                                                                                                                                                                                                                               531                                                                                                                           694              754
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0 ; only for superseded entry 2DTG: 8,12)

(no "SCOP Domain" information available for 4ZXB, only for superseded entry 2DTG replaced by 4ZXB)

(-) CATH Domains  (0, 0 ; only for superseded entry 2DTG: 3,14)

(no "CATH Domain" information available for 4ZXB, only for superseded entry 2DTG replaced by 4ZXB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZXB)

(-) Gene Ontology  (123, 140)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:153 - Pro A:154   [ RasMol ]  
    Glu C:148 - Pro C:149   [ RasMol ]  
    Gly C:8 - Pro C:9   [ RasMol ]  
    Phe A:151 - Pro A:152   [ RasMol ]  
    Phe C:146 - Pro C:147   [ RasMol ]  
    Pro E:243 - Pro E:244   [ RasMol ]  
    Ser B:7 - Pro B:8   [ RasMol ]  
    Ser D:7 - Pro D:8   [ RasMol ]  
    Trp A:193 - Pro A:194   [ RasMol ]  
    Tyr B:145 - Pro B:146   [ RasMol ]  
    Tyr D:140 - Pro D:141   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zxb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A2P1G9_MOUSE | A2P1G9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  GCAM_MOUSE | P01865
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IGKC_MOUSE | P01837
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  INSR_HUMAN | P06213
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  U5LP42_MOUSE | U5LP42
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A2P1G9_MOUSE | A2P1G9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GCAM_MOUSE | P01865
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IGKC_MOUSE | P01837
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  INSR_HUMAN | P06213
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  U5LP42_MOUSE | U5LP42
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GCAM_MOUSE | P01865: 1axt 1dqj 1e4w 1egj 1flr 1fpt 1ggb 1ggc 1kb5 1lo0 1nby 1nbz 1nca 1ncb 1ncc 1ncd 1ncw 1nd0 1ndg 1ndm 1orq 1plg 1ru9 1rua 1ruk 1rul 1rum 1rup 1yee 3fo9 3j3p 4fab
        IGKC_MOUSE | P01837: 15c8 1a0q 1a3l 1ahw 1ai1 1aif 1c12 1cf8 1cfn 1cfq 1cfs 1cft 1cic 1ck0 1ct8 1dqj 1dqm 1dqq 1e4w 1e4x 1ehl 1emt 1f11 1fai 1fbi 1fdl 1fe8 1fgn 1fj1 1fl3 1fns 1frg 1fsk 1gpo 1hh6 1hh9 1hi6 1i8m 1iai 1igy 1jnl 1jnn 1jrh 1k4c 1k4d 1kb5 1kc5 1kcr 1kcs 1kcu 1kcv 1ken 1kno 1lo0 1mf2 1mh5 1mlb 1mlc 1n5y 1n6q 1nby 1nbz 1ndg 1ndm 1oak 1ob1 1orq 1ors 1osp 1ots 1ott 1otu 1p2c 1p7k 1psk 1q9o 1q9w 1qgc 1r0a 1r24 1r3i 1r3j 1r3k 1r3l 1rih 1ruq 1rur 1s5h 1seq 1t03 1t4k 1ub5 1ub6 1uwx 1xf2 1xf3 1xf4 1xgp 1xgq 1xgu 25c8 2a6d 2a6k 2adf 2adj 2ajs 2aju 2ajv 2ajx 2ajy 2ajz 2ak1 2bob 2boc 2ck0 2f19 2fr4 2g5b 2h8p 2hg5 2hrp 2mpa 2nr6 2q76 2r1w 2r1y 2r23 2r2b 2uyl 2v17 2v7h 2vc2 2vdk 2vdl 2vdm 2vdn 2vdo 2vdp 2vdq 2vdr 2vl5 2vq1 2vwe 2w60 2w65 2w9d 2w9e 2z91 2z92 2z93 2zjs 35c8 3bae 3bgf 3bkc 3bkj 3bkm 3bpc 3bqu 3bsz 3bt2 3bz4 3c5s 3c6s 3cfb 3cfc 3cfd 3cfe 3ck0 3cle 3clf 3cmo 3cvh 3cvi 3d9a 3ejz 3eot 3f7v 3f7y 3fb6 3hfm 4kk5 4kk8 4qnp 6fab
        INSR_HUMAN | P06213: 1gag 1i44 1ir3 1irk 1p14 1rqq 2auh 2b4s 2hr7 2mfr 2z8c 3bu3 3bu5 3bu6 3ekk 3ekn 3eta 3w11 3w12 3w13 3w14 4ibm 4oga 4xlv 4xss 4xst 5e1s 5hhw 5j3h
        U5LP42_MOUSE | U5LP42: 1rih
UniProtKB/TrEMBL
        A2P1G9_MOUSE | A2P1G9: 1cgs 1ynk 1ynl 2cgr

(-) Related Entries Specified in the PDB File

2dtg THIS ENTRY REPLACES 2DTG AND 3LOH.
3loh THIS ENTRY REPLACES 2DTG AND 3LOH.