Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  KINASE DOMAIN OF INSULIN RECEPTOR COMPLEXED WITH A PYRROLO PYRIDINE INHIBITOR
 
Authors :  S. Patnaik, K. Stevens, R. Gerding, F. Deanda, B. Shotwell, J. Tang, T. H H. Nakamura, A. Leesnitzer, A. Hassell, L. Shewchuk, R. Kumar, H. Lei, S. Chamberlain
Date :  07 Oct 08  (Deposition) - 26 May 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Atp-Binding, Carbohydrate Metabolism, Cleavage On Pair Of Basic Residues, Diabetes Mellitus, Disease Mutation, Glycoprotein, Kinase, Membrane, Nucleotide-Binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-Protein Kinase, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Patnaik, K. L. Stevens, R. Gerding, F. Deanda, J. B. Shotwell, J. Tang, T. Hamajima, H. Nakamura, M. A. Leesnitzer, A. M. Hassell, L. M. Shewchuck, R. Kumar, H. Lei, S. D. Chamberlain
Discovery Of 3, 5-Disubstituted-1H-Pyrrolo[2, 3-B]Pyridines A Potent Inhibitors Of The Insulin-Like Growth Factor-1 Receptor (Igf-1R) Tyrosine Kinase.
Bioorg. Med. Chem. Lett. V. 19 3136 2009
PubMed-ID: 19394223  |  Reference-DOI: 10.1016/J.BMCL.2008.12.110

(-) Compounds

Molecule 1 - INSULIN RECEPTOR, KINASE DOMAIN
    Chains: A, B
    EC Number: 2.7.10.1
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Plasmid: PFASTBAC
    Expression System Strain: SF21
    Expression System Taxid: 7108
    Expression System Vector Type: BACULOVIRUS
    Fragment: KINASE DOMAIN
    Gene: INSR
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IR, INSULIN RECEPTOR SUBUNIT ALPHA, INSULIN RECEPTOR SUBUNIT BETA

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B
Biological Unit 3 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
13512Ligand/Ion1-(3-{5-[4-(AMINOMETHYL)PHENYL]-1H-PYRROLO[2,3-B]PYRIDIN-3-YL}PHENYL)-3-(2-PHENOXYPHENYL)UREA
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
13511Ligand/Ion1-(3-{5-[4-(AMINOMETHYL)PHENYL]-1H-PYRROLO[2,3-B]PYRIDIN-3-YL}PHENYL)-3-(2-PHENOXYPHENYL)UREA
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
13511Ligand/Ion1-(3-{5-[4-(AMINOMETHYL)PHENYL]-1H-PYRROLO[2,3-B]PYRIDIN-3-YL}PHENYL)-3-(2-PHENOXYPHENYL)UREA
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
13512Ligand/Ion1-(3-{5-[4-(AMINOMETHYL)PHENYL]-1H-PYRROLO[2,3-B]PYRIDIN-3-YL}PHENYL)-3-(2-PHENOXYPHENYL)UREA

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:1002 , ALA A:1028 , LYS A:1030 , GLU A:1047 , MET A:1051 , VAL A:1059 , VAL A:1060 , GLU A:1077 , MET A:1079 , PHE A:1128 , MET A:1139 , ILE A:1148 , GLY A:1149 , ASP A:1150 , HOH A:3155BINDING SITE FOR RESIDUE 351 A2001
2AC2SOFTWARELEU B:1002 , ALA B:1028 , GLU B:1047 , VAL B:1050 , MET B:1051 , VAL B:1060 , MET B:1076 , GLU B:1077 , MET B:1079 , GLY B:1082 , PHE B:1128 , MET B:1139 , ILE B:1148 , GLY B:1149 , ASP B:1150BINDING SITE FOR RESIDUE 351 B2001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ETA)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gln A:1070 -Pro A:1071
2Gln B:1070 -Pro B:1071

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (23, 46)

Asymmetric Unit (23, 46)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_004092R1020QINSR_HUMANDisease (IRAN type A)121913148A/BR993Q
02UniProtVAR_015922I1023FINSR_HUMANPolymorphism  ---A/BI996F
03UniProtVAR_004093G1035VINSR_HUMANDisease (IRAN type A)121913135A/BG1008V
04UniProtVAR_015923A1055VINSR_HUMANDisease (IRAN type A)  ---A/BA1028V
05UniProtVAR_041432L1065VINSR_HUMANPolymorphism56395521A/BL1038V
06UniProtVAR_004094A1075DINSR_HUMANDisease (IRAN type A)  ---A/BA1048D
07UniProtVAR_015924K1095EINSR_HUMANUnclassified  ---A/BK1068E
08UniProtVAR_015925R1119WINSR_HUMANDisease (LEPRCH)  ---A/BR1092W
09UniProtVAR_015926I1143TINSR_HUMANDisease (RMS)  ---A/BI1116T
10UniProtVAR_015927R1158QINSR_HUMANDisease (NIDDM)  ---A/BR1131Q
11UniProtVAR_015928R1158WINSR_HUMANDisease (RMS)111993466A/BR1131W
12UniProtVAR_004095A1161TINSR_HUMANDisease (IRAN type A)28933084A/BA1134T
13UniProtVAR_004096A1162EINSR_HUMANDisease (IRAN type A)121913154A/BA1135E
14UniProtVAR_004097M1180IINSR_HUMANPolymorphism121913157A/BM1153I
15UniProtVAR_004098R1191QINSR_HUMANDisease (NIDDM)121913150A/BR1164Q
16UniProtVAR_015929R1201QINSR_HUMANDisease (IRAN type A)28933086A/BR1174Q
17UniProtVAR_015930R1201WINSR_HUMANDisease (RMS)  ---A/BR1174W
18UniProtVAR_004099P1205LINSR_HUMANDisease (IRAN type A)  ---A/BP1178L
19UniProtVAR_015931E1206DINSR_HUMANDisease (IRAN type A)  ---A/BE1179D
20UniProtVAR_015932E1206KINSR_HUMANDisease (LEPRCH)  ---A/BE1179K
21UniProtVAR_004100W1220LINSR_HUMANDisease (IRAN type A)52800171A/BW1193L
22UniProtVAR_004101W1227SINSR_HUMANDisease (IRAN type A)121913140A/BW1200S
23UniProtVAR_041433T1282AINSR_HUMANPolymorphism55875349A/BT1255A

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (23, 23)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_004092R1020QINSR_HUMANDisease (IRAN type A)121913148AR993Q
02UniProtVAR_015922I1023FINSR_HUMANPolymorphism  ---AI996F
03UniProtVAR_004093G1035VINSR_HUMANDisease (IRAN type A)121913135AG1008V
04UniProtVAR_015923A1055VINSR_HUMANDisease (IRAN type A)  ---AA1028V
05UniProtVAR_041432L1065VINSR_HUMANPolymorphism56395521AL1038V
06UniProtVAR_004094A1075DINSR_HUMANDisease (IRAN type A)  ---AA1048D
07UniProtVAR_015924K1095EINSR_HUMANUnclassified  ---AK1068E
08UniProtVAR_015925R1119WINSR_HUMANDisease (LEPRCH)  ---AR1092W
09UniProtVAR_015926I1143TINSR_HUMANDisease (RMS)  ---AI1116T
10UniProtVAR_015927R1158QINSR_HUMANDisease (NIDDM)  ---AR1131Q
11UniProtVAR_015928R1158WINSR_HUMANDisease (RMS)111993466AR1131W
12UniProtVAR_004095A1161TINSR_HUMANDisease (IRAN type A)28933084AA1134T
13UniProtVAR_004096A1162EINSR_HUMANDisease (IRAN type A)121913154AA1135E
14UniProtVAR_004097M1180IINSR_HUMANPolymorphism121913157AM1153I
15UniProtVAR_004098R1191QINSR_HUMANDisease (NIDDM)121913150AR1164Q
16UniProtVAR_015929R1201QINSR_HUMANDisease (IRAN type A)28933086AR1174Q
17UniProtVAR_015930R1201WINSR_HUMANDisease (RMS)  ---AR1174W
18UniProtVAR_004099P1205LINSR_HUMANDisease (IRAN type A)  ---AP1178L
19UniProtVAR_015931E1206DINSR_HUMANDisease (IRAN type A)  ---AE1179D
20UniProtVAR_015932E1206KINSR_HUMANDisease (LEPRCH)  ---AE1179K
21UniProtVAR_004100W1220LINSR_HUMANDisease (IRAN type A)52800171AW1193L
22UniProtVAR_004101W1227SINSR_HUMANDisease (IRAN type A)121913140AW1200S
23UniProtVAR_041433T1282AINSR_HUMANPolymorphism55875349AT1255A

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (23, 23)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_004092R1020QINSR_HUMANDisease (IRAN type A)121913148BR993Q
02UniProtVAR_015922I1023FINSR_HUMANPolymorphism  ---BI996F
03UniProtVAR_004093G1035VINSR_HUMANDisease (IRAN type A)121913135BG1008V
04UniProtVAR_015923A1055VINSR_HUMANDisease (IRAN type A)  ---BA1028V
05UniProtVAR_041432L1065VINSR_HUMANPolymorphism56395521BL1038V
06UniProtVAR_004094A1075DINSR_HUMANDisease (IRAN type A)  ---BA1048D
07UniProtVAR_015924K1095EINSR_HUMANUnclassified  ---BK1068E
08UniProtVAR_015925R1119WINSR_HUMANDisease (LEPRCH)  ---BR1092W
09UniProtVAR_015926I1143TINSR_HUMANDisease (RMS)  ---BI1116T
10UniProtVAR_015927R1158QINSR_HUMANDisease (NIDDM)  ---BR1131Q
11UniProtVAR_015928R1158WINSR_HUMANDisease (RMS)111993466BR1131W
12UniProtVAR_004095A1161TINSR_HUMANDisease (IRAN type A)28933084BA1134T
13UniProtVAR_004096A1162EINSR_HUMANDisease (IRAN type A)121913154BA1135E
14UniProtVAR_004097M1180IINSR_HUMANPolymorphism121913157BM1153I
15UniProtVAR_004098R1191QINSR_HUMANDisease (NIDDM)121913150BR1164Q
16UniProtVAR_015929R1201QINSR_HUMANDisease (IRAN type A)28933086BR1174Q
17UniProtVAR_015930R1201WINSR_HUMANDisease (RMS)  ---BR1174W
18UniProtVAR_004099P1205LINSR_HUMANDisease (IRAN type A)  ---BP1178L
19UniProtVAR_015931E1206DINSR_HUMANDisease (IRAN type A)  ---BE1179D
20UniProtVAR_015932E1206KINSR_HUMANDisease (LEPRCH)  ---BE1179K
21UniProtVAR_004100W1220LINSR_HUMANDisease (IRAN type A)52800171BW1193L
22UniProtVAR_004101W1227SINSR_HUMANDisease (IRAN type A)121913140BW1200S
23UniProtVAR_041433T1282AINSR_HUMANPolymorphism55875349BT1255A

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (23, 46)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_004092R1020QINSR_HUMANDisease (IRAN type A)121913148A/BR993Q
02UniProtVAR_015922I1023FINSR_HUMANPolymorphism  ---A/BI996F
03UniProtVAR_004093G1035VINSR_HUMANDisease (IRAN type A)121913135A/BG1008V
04UniProtVAR_015923A1055VINSR_HUMANDisease (IRAN type A)  ---A/BA1028V
05UniProtVAR_041432L1065VINSR_HUMANPolymorphism56395521A/BL1038V
06UniProtVAR_004094A1075DINSR_HUMANDisease (IRAN type A)  ---A/BA1048D
07UniProtVAR_015924K1095EINSR_HUMANUnclassified  ---A/BK1068E
08UniProtVAR_015925R1119WINSR_HUMANDisease (LEPRCH)  ---A/BR1092W
09UniProtVAR_015926I1143TINSR_HUMANDisease (RMS)  ---A/BI1116T
10UniProtVAR_015927R1158QINSR_HUMANDisease (NIDDM)  ---A/BR1131Q
11UniProtVAR_015928R1158WINSR_HUMANDisease (RMS)111993466A/BR1131W
12UniProtVAR_004095A1161TINSR_HUMANDisease (IRAN type A)28933084A/BA1134T
13UniProtVAR_004096A1162EINSR_HUMANDisease (IRAN type A)121913154A/BA1135E
14UniProtVAR_004097M1180IINSR_HUMANPolymorphism121913157A/BM1153I
15UniProtVAR_004098R1191QINSR_HUMANDisease (NIDDM)121913150A/BR1164Q
16UniProtVAR_015929R1201QINSR_HUMANDisease (IRAN type A)28933086A/BR1174Q
17UniProtVAR_015930R1201WINSR_HUMANDisease (RMS)  ---A/BR1174W
18UniProtVAR_004099P1205LINSR_HUMANDisease (IRAN type A)  ---A/BP1178L
19UniProtVAR_015931E1206DINSR_HUMANDisease (IRAN type A)  ---A/BE1179D
20UniProtVAR_015932E1206KINSR_HUMANDisease (LEPRCH)  ---A/BE1179K
21UniProtVAR_004100W1220LINSR_HUMANDisease (IRAN type A)52800171A/BW1193L
22UniProtVAR_004101W1227SINSR_HUMANDisease (IRAN type A)121913140A/BW1200S
23UniProtVAR_041433T1282AINSR_HUMANPolymorphism55875349A/BT1255A

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.INSR_HUMAN1029-1057
 
  2A:1002-1030
B:1002-1030
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.INSR_HUMAN1155-1167
 
  2A:1128-1140
B:1128-1140
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.INSR_HUMAN1183-1191
 
  2A:1156-1164
B:1156-1164
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.INSR_HUMAN1029-1057
 
  1A:1002-1030
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.INSR_HUMAN1155-1167
 
  1A:1128-1140
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.INSR_HUMAN1183-1191
 
  1A:1156-1164
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.INSR_HUMAN1029-1057
 
  1-
B:1002-1030
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.INSR_HUMAN1155-1167
 
  1-
B:1128-1140
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.INSR_HUMAN1183-1191
 
  1-
B:1156-1164
Biological Unit 3 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.INSR_HUMAN1029-1057
 
  2A:1002-1030
B:1002-1030
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.INSR_HUMAN1155-1167
 
  2A:1128-1140
B:1128-1140
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.INSR_HUMAN1183-1191
 
  2A:1156-1164
B:1156-1164

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003028501ENSE00001283493chr19:7294011-7293803209INSR_HUMAN1-34340--
1.2ENST000003028502ENSE00001157643chr19:7267907-7267356552INSR_HUMAN34-2181850--
1.3ENST000003028503ENSE00001157630chr19:7184648-7184327322INSR_HUMAN218-3251080--
1.4ENST000003028504ENSE00001157622chr19:7174742-7174594149INSR_HUMAN325-375510--
1.5ENST000003028505ENSE00001157620chr19:7172445-7172301145INSR_HUMAN375-423490--
1.6ENST000003028506ENSE00001157613chr19:7170762-7170548215INSR_HUMAN423-495730--
1.7ENST000003028507ENSE00001157603chr19:7168105-7167979127INSR_HUMAN495-537430--
1.8ENST000003028508ENSE00001157594chr19:7166415-7166165251INSR_HUMAN537-621850--
1.9ENST000003028509ENSE00001157586chr19:7163210-7163043168INSR_HUMAN621-677570--
1.10ENST0000030285010ENSE00001157582chr19:7152938-7152737202INSR_HUMAN677-744680--
1.11ENST0000030285011ENSE00001157509chr19:7150543-715050836INSR_HUMAN744-756130--
1.12ENST0000030285012ENSE00001157577chr19:7143101-7142827275INSR_HUMAN756-848930--
1.13ENST0000030285013ENSE00001157569chr19:7141827-7141688140INSR_HUMAN848-894470--
1.14ENST0000030285014ENSE00001157563chr19:7132328-7132169160INSR_HUMAN895-948540--
1.15ENST0000030285015ENSE00001157555chr19:7128965-7128863103INSR_HUMAN948-982350--
1.16ENST0000030285016ENSE00001157546chr19:7126662-712659568INSR_HUMAN982-1005240--
1.17ENST0000030285017ENSE00001157539chr19:7125538-7125294245INSR_HUMAN1005-1086822A:990-1059
B:990-1059
70
70
1.18ENST0000030285018ENSE00001157531chr19:7123000-7122890111INSR_HUMAN1087-1123372A:1060-1096
B:1060-1096
37
37
1.19ENST0000030285019ENSE00001157526chr19:7122784-7122625160INSR_HUMAN1124-1177542A:1097-1150
B:1097-1150
54
54
1.20ENST0000030285020ENSE00001686057chr19:7120760-7120631130INSR_HUMAN1177-1220442A:1150-1193 (gaps)
B:1150-1193 (gaps)
44
44
1.21ENST0000030285021ENSE00001157513chr19:7119594-7119460135INSR_HUMAN1220-1265462A:1193-1238
B:1193-1238
46
46
1.22ENST0000030285022ENSE00001383357chr19:7117421-71122665156INSR_HUMAN1265-13821182A:1238-1283
B:1238-1283
46
46

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:293
 aligned with INSR_HUMAN | P06213 from UniProtKB/Swiss-Prot  Length:1382

    Alignment length:294
                                  1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146      1156      1166      1176      1186      1196      1206      1216      1226      1236      1246      1256      1266      1276      1286      1296      1306    
          INSR_HUMAN   1017 EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK 1310
               SCOP domains d3etaa_ A: Insulin receptor                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 3etaA01 A:990-1078 Phosphorylase Kinase; domain 1                                        3etaA02 A:1079-1283 Transferase(Phosphotransferase) domain 1                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.eeeeeeeee....eeeeeeee.......eeeeeee......hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......hhhhhhhhee..-..eehhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
             SAPs(SNPs) (1) ---Q--F-----------V-------------------V---------V---------D-------------------E-----------------------W-----------------------T--------------Q--TE-----------------I----------Q---------Q---LD-------------L------S------------------------------------------------------A---------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------W------------------------------------------W----K-------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.17  PDB: A:990-1059 UniProt: 1005-1086 [INCOMPLETE]            Exon 1.18  PDB: A:1060-1096          Exon 1.19  PDB: A:1097-1150 UniProt: 1124-1177        ------------------------------------------Exon 1.21  PDB: A:1193-1238 UniProt: 1220-1265--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.20  PDB: A:1150-1193 (gaps)          --------------------------------------------Exon 1.22  PDB: A:1238-1283 UniProt: 1265-1382 Transcript 1 (2)
                3eta A  990 EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKG-KGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK 1283
                                   999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279    
                                                                                                                                                                                                         1166 |                                                                                                                   
                                                                                                                                                                                                           1168                                                                                                                   

Chain B from PDB  Type:PROTEIN  Length:292
 aligned with INSR_HUMAN | P06213 from UniProtKB/Swiss-Prot  Length:1382

    Alignment length:294
                                  1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146      1156      1166      1176      1186      1196      1206      1216      1226      1236      1246      1256      1266      1276      1286      1296      1306    
          INSR_HUMAN   1017 EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK 1310
               SCOP domains d3etab_ B: Insulin receptor                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 3etaB01 B:990-1078 Phosphorylase Kinase; domain 1                                        3etaB02 B:1079-1283 Transferase(Phosphotransferase) domain 1                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.eeeeeeeee....eeeeeeee.......eeeeeee......hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee.........hhhhhee.--..eehhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
             SAPs(SNPs) (1) ---Q--F-----------V-------------------V---------V---------D-------------------E-----------------------W-----------------------T--------------Q--TE-----------------I----------Q---------Q---LD-------------L------S------------------------------------------------------A---------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------W------------------------------------------W----K-------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.17  PDB: B:990-1059 UniProt: 1005-1086 [INCOMPLETE]            Exon 1.18  PDB: B:1060-1096          Exon 1.19  PDB: B:1097-1150 UniProt: 1124-1177        ------------------------------------------Exon 1.21  PDB: B:1193-1238 UniProt: 1220-1265--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.20  PDB: B:1150-1193 (gaps)          --------------------------------------------Exon 1.22  PDB: B:1238-1283 UniProt: 1265-1382 Transcript 1 (2)
                3eta B  990 EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRK--KGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK 1283
                                   999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159     |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279    
                                                                                                                                                                                                        1165  |                                                                                                                   
                                                                                                                                                                                                           1168                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ETA)

(-) Gene Ontology  (98, 98)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (INSR_HUMAN | P06213)
molecular function
    GO:0043423    3-phosphoinositide-dependent protein kinase binding    Interacting selectively and non-covalently with a 3-phosphoinositide-dependent protein kinase.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0051425    PTB domain binding    Interacting selectively and non-covalently with a phosphotyrosine-binding (PTB) domain of a protein.
    GO:0043559    insulin binding    Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0043560    insulin receptor substrate binding    Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
    GO:0005009    insulin-activated receptor activity    Combining with insulin and transmitting the signal across the plasma membrane to initiate a change in cell activity.
    GO:0031994    insulin-like growth factor I binding    Interacting selectively and non-covalently with insulin-like growth factor I.
    GO:0031995    insulin-like growth factor II binding    Interacting selectively and non-covalently with insulin-like growth factor II.
    GO:0005159    insulin-like growth factor receptor binding    Interacting selectively and non-covalently with the insulin-like growth factor receptor.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0031405    lipoic acid binding    Interacting selectively and non-covalently with lipoic acid, 1,2-dithiolane-3-pentanoic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0043548    phosphatidylinositol 3-kinase binding    Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004716    signal transducer, downstream of receptor, with protein tyrosine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0032148    activation of protein kinase B activity    Any process that initiates the activity of the inactive enzyme protein kinase B.
    GO:0032147    activation of protein kinase activity    Any process that initiates the activity of an inactive protein kinase.
    GO:0030325    adrenal gland development    The process whose specific outcome is the progression of the adrenal gland over time, from its formation to the mature structure. This gland can either be a discrete structure located bilaterally above each kidney, or a cluster of cells in the head kidney that perform the functions of the adrenal gland. In either case, this organ consists of two cells types, aminergic chromaffin cells and steroidogenic cortical cells.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0071363    cellular response to growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth factor stimulus.
    GO:0032869    cellular response to insulin stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0008544    epidermis development    The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
    GO:0031017    exocrine pancreas development    The process whose specific outcome is the progression of the exocrine pancreas over time, from its formation to the mature structure. The exocrine pancreas produces and store zymogens of digestive enzymes, such as chymotrypsinogen and trypsinogen in the acinar cells.
    GO:0045444    fat cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an adipocyte, an animal connective tissue cell specialized for the synthesis and storage of fat.
    GO:0042593    glucose homeostasis    Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
    GO:0003007    heart morphogenesis    The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0008286    insulin receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0030238    male sex determination    The specification of male sex of an individual organism.
    GO:0010629    negative regulation of gene expression    Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0001933    negative regulation of protein phosphorylation    Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
    GO:0032410    negative regulation of transporter activity    Any process that stops or reduces the activity of a transporter.
    GO:0038083    peptidyl-tyrosine autophosphorylation    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0045740    positive regulation of DNA replication    Any process that activates or increases the frequency, rate or extent of DNA replication.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0048639    positive regulation of developmental growth    Any process that activates, maintains or increases the rate of developmental growth.
    GO:0046326    positive regulation of glucose import    Any process that activates or increases the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle.
    GO:0045725    positive regulation of glycogen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
    GO:0045821    positive regulation of glycolytic process    Any process that activates or increases the frequency, rate or extent of glycolysis.
    GO:0010560    positive regulation of glycoprotein biosynthetic process    Any process that increases the rate, frequency, or extent of the chemical reactions and pathways resulting in the formation of glycoproteins, any protein that contains covalently bound glycose (i.e. monosaccharide) residues; the glycose occurs most commonly as oligosaccharide or fairly small polysaccharide but occasionally as monosaccharide.
    GO:0051446    positive regulation of meiotic cell cycle    Any process that activates or increases the frequency, rate or extent of progression through the meiotic cell cycle.
    GO:0045840    positive regulation of mitotic nuclear division    Any process that activates or increases the frequency, rate or extent of mitosis.
    GO:0045429    positive regulation of nitric oxide biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
    GO:0051897    positive regulation of protein kinase B signaling    Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0060267    positive regulation of respiratory burst    Any process that increases the rate frequency or extent of a phase of elevated metabolic activity, during which oxygen consumption increases; this leads to the production, by an NADH dependent system, of hydrogen peroxide (H2O2), superoxide anions and hydroxyl radicals.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0045995    regulation of embryonic development    Any process that modulates the frequency, rate or extent of embryonic development.
    GO:2000194    regulation of female gonad development    Any process that modulates the frequency, rate or extent of female gonad development.
    GO:0010310    regulation of hydrogen peroxide metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving hydrogen peroxide.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0014823    response to activity    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an activity stimulus.
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0051384    response to glucocorticoid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0009725    response to hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
    GO:0032868    response to insulin    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0010042    response to manganese ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a manganese ion stimulus.
    GO:0031667    response to nutrient levels    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
    GO:0033574    response to testosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
    GO:0034612    response to tumor necrosis factor    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a tumor necrosis factor stimulus.
    GO:0033280    response to vitamin D    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin D stimulus.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0019087    transformation of host cell by virus    Any virus-induced change in the morphological, biochemical, or growth parameters of a cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005901    caveola    A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005899    insulin receptor complex    A disulfide-bonded, heterotetrameric receptor complex. The alpha chains are entirely extracellular, while each beta chain has one transmembrane domain. The ligand binds to the alpha subunit extracellular domain and the kinase is associated with the beta subunit intracellular domain.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    351  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:1070 - Pro A:1071   [ RasMol ]  
    Gln B:1070 - Pro B:1071   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3eta
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  INSR_HUMAN | P06213
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  125853
    Disease Information: OMIM
  246200
    Disease Information: OMIM
  262190
    Disease Information: OMIM
  610549
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  INSR_HUMAN | P06213
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        INSR_HUMAN | P06213: 1gag 1i44 1ir3 1irk 1p14 1rqq 2auh 2b4s 2hr7 2mfr 2z8c 3bu3 3bu5 3bu6 3ekk 3ekn 3w11 3w12 3w13 3w14 4ibm 4oga 4xlv 4xss 4xst 4zxb 5e1s 5hhw 5j3h

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ETA)