Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRYPSIN IN COMPLEX WITH WITH BPTI MUTANT AMINOBUTYRIC ACID
 
Authors :  B. Loll, S. Ye, A. A. Berger, U. Muelow, C. Alings, M. C. Wahl, B. Koksch
Date :  06 Feb 15  (Deposition) - 24 Jun 15  (Release) - 26 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.37
Chains :  Asym./Biol. Unit :  E,I
Keywords :  Hydrolase Inhibitors, Metal-Binding, Serine Protease, Hydrolase- Hydrolase Inhibitor Complex, Hydrolase-Hydrolase Inhibitor Complex Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Ye, B. Loll, A. A. Berger, U. Muelow, C. Alings, M. C. Wahl, B. Koksch
Fluorine Teams Up With Water To Restore Inhibitor Activity To Mutant Bpti
Chem Sci V. 6 5246 2015
PubMed: search  |  Reference-DOI: 10.1039/C4SC03227F

(-) Compounds

Molecule 1 - CATIONIC TRYPSIN
    ChainsE
    EC Number3.4.21.4
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymBETA-TRYPSIN, TRYPSIN
 
Molecule 2 - PANCREATIC TRYPSIN INHIBITOR
    ChainsI
    EngineeredYES
    FragmentUNP RESIDUES 36-93
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsNON-CANONICAL AMINO ACID WAS INCOPORATED
    Other Details - SourceSYNTHESIZED
    SynonymAPROTININ,BASIC PROTEASE INHIBITOR,BPTI
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit EI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric/Biological Unit (4, 14)
No.NameCountTypeFull Name
1ABA1Mod. Amino AcidALPHA-AMINOBUTYRIC ACID
2CA1Ligand/IonCALCIUM ION
3GOL2Ligand/IonGLYCEROL
4SO410Ligand/IonSULFATE ION

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR E:59 , LYS E:60 , SER E:61 , HOH E:410 , HOH E:412 , HOH E:416 , HOH E:432 , HOH E:435 , HOH E:591 , LYS I:46binding site for residue SO4 E 301
02AC2SOFTWARELYS E:87 , LYS E:107 , ASN E:247 , HOH E:401 , HOH E:406 , HOH E:674binding site for residue SO4 E 302
03AC3SOFTWAREPRO E:152 , ASP E:153 , VAL E:154 , LYS E:156 , HOH E:610binding site for residue SO4 E 303
04AC4SOFTWAREASN E:95 , THR E:98 , ASN E:100 , ASN E:101 , HOH E:632binding site for residue SO4 E 304
05AC5SOFTWAREPRO E:173 , GLY E:174 , HOH E:503 , HOH E:611 , HOH E:631binding site for residue SO4 E 305
06AC6SOFTWAREASN E:100 , ASN E:179 , SO4 E:307 , HOH E:534 , HOH E:656binding site for residue SO4 E 306
07AC7SOFTWARETHR E:177 , SER E:178 , SO4 E:306 , HOH E:570binding site for residue SO4 E 307
08AC8SOFTWAREGLU E:70 , ASN E:72 , VAL E:75 , GLU E:80 , HOH E:493 , HOH E:502binding site for residue CA E 308
09AC9SOFTWARETYR E:20 , CYS E:22 , THR E:26binding site for residue GOL E 309
10AD1SOFTWAREASN E:48 , LYS E:241 , ILE E:244 , HOH E:409 , HOH E:497binding site for residue GOL E 310
11AD2SOFTWAREARG I:42 , HOH I:218 , HOH I:227 , HOH I:243 , HOH I:277 , HOH I:282 , HOH I:283binding site for residue SO4 I 101
12AD3SOFTWAREARG I:20 , TYR I:35 , HOH I:207 , HOH I:219 , HOH I:252 , HOH I:261 , HOH I:286binding site for residue SO4 I 102
13AD4SOFTWAREPRO I:9 , TYR I:10 , THR I:11 , GLY I:12 , HOH I:249 , HOH I:258 , HOH I:267binding site for residue SO4 I 103

(-) SS Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1E:22 -E:157
2E:42 -E:58
3E:128 -E:234
4E:136 -E:203
5E:168 -E:182
6E:193 -E:221
7I:5 -I:55
8I:14 -I:38
9I:30 -I:51

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4Y0Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Y0Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Y0Z)

(-) Exons   (0, 0)

(no "Exon" information available for 4Y0Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain E from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y0z E  16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 247
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180       190       200     ||214       224       234       244   
                                             34|                            67|                                                     125|  ||                                                                       206|                                    
                                              37                             69                                                      127  ||                                                                        211                                    
                                                                                                                                        130|                                                                                                               
                                                                                                                                         132                                                                                                               

Chain I from PDB  Type:PROTEIN  Length:57
                                                                                         
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                 4y0z I   2 PDFCLEPPYTGPCxARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA  58
                                    11   |    21        31        41        51       
                                        15-ABA                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Y0Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Y0Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Y0Z)

(-) Gene Ontology  (17, 19)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ABA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4y0z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4y0z
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BPT1_BOVIN | P00974
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRY1_BOVIN | P00760
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BPT1_BOVIN | P00974
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRY1_BOVIN | P00760
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BPT1_BOVIN | P009741aal 1b0c 1bhc 1bpi 1bpt 1brb 1bth 1bti 1bz5 1bzx 1cbw 1co7 1d0d 1eaw 1ejm 1f5r 1f7z 1fak 1fan 1fy8 1g6x 1jv8 1jv9 1k09 1k6u 1ld5 1ld6 1mtn 1nag 1oa5 1oa6 1p2i 1p2j 1p2k 1p2m 1p2n 1p2o 1p2q 1pit 1qlq 1t7c 1t8l 1t8m 1t8n 1t8o 1tpa 1uua 1uub 1ykt 1ylc 1yld 2fi3 2fi4 2fi5 2ftl 2ftm 2hex 2ijo 2kai 2ptc 2r9p 2ra3 2tgp 2tpi 2zjx 2zvx 3btd 3bte 3btf 3btg 3bth 3btk 3btm 3btq 3btt 3btw 3fp6 3fp7 3fp8 3gym 3ldi 3ldj 3ldm 3otj 3p92 3p95 3tgi 3tgj 3tgk 3tpi 3u1j 3wny 4bnr 4dg4 4pti 4tpi 4wwy 4wxv 4y0y 4y10 4y11 5jb4 5jb5 5jb6 5jb7 5pti 6pti 7pti 8pti 9pti
        TRY1_BOVIN | P007601aq7 1auj 1az8 1bju 1bjv 1btp 1btw 1btx 1bty 1btz 1c1n 1c1o 1c1p 1c1q 1c1r 1c1s 1c1t 1c2d 1c2e 1c2f 1c2g 1c2h 1c2i 1c2j 1c2k 1c2l 1c2m 1c5p 1c5q 1c5r 1c5s 1c5t 1c5u 1c5v 1c9t 1ce5 1cu7 1cu8 1cu9 1d6r 1eb2 1ejm 1ezx 1f0t 1f0u 1f2s 1g36 1g3b 1g3c 1g3d 1g3e 1g9i 1gbt 1ghz 1gi0 1gi1 1gi2 1gi3 1gi4 1gi5 1gi6 1gj6 1hj9 1j8a 1jir 1jrs 1jrt 1k1i 1k1j 1k1l 1k1m 1k1n 1k1o 1k1p 1lqe 1max 1may 1mts 1mtu 1mtv 1mtw 1n6x 1n6y 1nc6 1ntp 1o2h 1o2i 1o2j 1o2k 1o2l 1o2m 1o2n 1o2o 1o2p 1o2q 1o2r 1o2s 1o2t 1o2u 1o2v 1o2w 1o2x 1o2y 1o2z 1o30 1o31 1o32 1o33 1o34 1o35 1o36 1o37 1o38 1o39 1o3a 1o3b 1o3c 1o3d 1o3e 1o3f 1o3g 1o3h 1o3i 1o3j 1o3k 1o3l 1o3m 1o3n 1o3o 1oph 1ox1 1oyq 1p2i 1p2j 1p2k 1ppc 1ppe 1pph 1qa0 1qb1 1qb6 1qb9 1qbn 1qbo 1qcp 1ql7 1ql8 1rxp 1s0q 1s0r 1sbw 1sfi 1smf 1tab 1taw 1tgb 1tgc 1tgn 1tgs 1tgt 1tio 1tld 1tng 1tnh 1tni 1tnj 1tnk 1tnl 1tpa 1tpo 1tpp 1tps 1tx7 1tx8 1tyn 1utn 1uto 1utp 1utq 1v2j 1v2k 1v2l 1v2m 1v2n 1v2o 1v2p 1v2q 1v2r 1v2s 1v2t 1v2u 1v2v 1v2w 1xuf 1xug 1xuh 1xui 1xuj 1xuk 1y3u 1y3v 1y3w 1y3x 1y3y 1y59 1y5a 1y5b 1y5u 1yp9 1yyy 1zr0 1zzz 2a7h 2age 2agg 2agi 2ah4 2ayw 2blv 2blw 2btc 2by5 2by6 2by7 2by8 2by9 2bya 2bza 2cmy 2d8w 2f3c 2fi3 2fi4 2fi5 2ftl 2ftm 2fx4 2fx6 2g55 2g5n 2g5v 2g81 2g8t 2iln 2j9n 2o9q 2otv 2oxs 2plx 2ptc 2ptn 2qn5 2qyi 2tga 2tgd 2tgp 2tgt 2tio 2tld 2tpi 2uuy 2xtt 2zdk 2zdl 2zdm 2zdn 2zfs 2zft 2zhd 2zq1 2zq2 3a7t 3a7v 3a7w 3a7x 3a7y 3a7z 3a80 3a81 3a82 3a83 3a84 3a85 3a86 3a87 3a88 3a89 3a8a 3a8b 3a8c 3a8d 3aas 3aau 3aav 3ati 3atk 3atl 3atm 3btd 3bte 3btf 3btg 3bth 3btk 3btm 3btq 3btt 3btw 3d65 3e8l 3gy2 3gy3 3gy4 3gy5 3gy6 3gy7 3gy8 3i29 3iti 3ljj 3ljo 3m35 3m7q 3mfj 3mi4 3nk8 3nkk 3otj 3plb 3plk 3plp 3pm3 3pmj 3ptb 3ptn 3pwb 3pwc 3pyh 3q00 3qk1 3rdz 3ru4 3rxa 3rxb 3rxc 3rxd 3rxe 3rxf 3rxg 3rxh 3rxi 3rxj 3rxk 3rxl 3rxm 3rxo 3rxp 3rxq 3rxr 3rxs 3rxt 3rxu 3rxv 3t25 3t26 3t27 3t28 3t29 3tpi 3unq 3unr 3uns 3uop 3upe 3uqo 3uqv 3uuz 3uwi 3uy9 3v0x 3v12 3v13 3veq 3vpk 4ab8 4ab9 4aba 4abb 4abd 4abe 4abf 4abg 4abh 4abi 4abj 4aoq 4aor 4b1t 4b2a 4b2b 4b2c 4gux 4hgc 4i8g 4i8h 4i8j 4i8k 4i8l 4j2y 4kts 4ktu 4mtb 4ncy 4niv 4niw 4nix 4niy 4tpi 4tpy 4u2w 4xoj 4y0y 4y10 4y11 4yta 5eg4 5f6m 5fxl 5gib 5gxp 5jyi 5k7r 5lgo 5lh8 5mn1 5mna 5mnb 5mnc 5mnx 5mny 5mon 5moo 5ptp 5t3h

(-) Related Entries Specified in the PDB File

4y0y 4y10 4y11