|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (6, 6)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YP9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YP9) |
PROSITE Motifs (3, 3)
Asymmetric/Biological Unit (3, 3)
|
||||||||||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:229 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 217 227 237 TRY1_BOVIN 18 VDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d 1yp9a_ A: Trypsin(ogen) SCOP domains CATH domains 1 yp9A01 1yp9A02 A:28-120,A:233-244 Trypsin-like serine proteases 1yp9A01 A:253-27,A:121-232 Trypsin-like serine proteases 1yp9A02 - CATH domains Pfam domains - Trypsin-1yp9A01 A:17-238 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------TRYPSIN_DOM PDB: A:17-243 UniProt: 24-244 -- PROSITE (1) PROSITE (2) -----------------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: A:253-63 (gaps) UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: A:151-194 UniProt: 154-199 Exon 1.5 PDB: A:195-245 (gaps) Transcript 1 (1) Transcript 1 (2) ---------------------------------------------------Exon 1.3 PDB: A:63-151 (gaps) UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 1yp9 A 253 I------VGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 245 | |19 29 || 41 51 61 || 72 82 92 102 112 122 || |134 144 154 164 174 184| | 192 202 || 216|| | 226 236 | 17 34| 67| 125| || 184A 188A 204| 217| | 253 37 69 127 || 209 219 | 130| 221A 132
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (10, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (TRY1_BOVIN | P00760)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|