Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  EXTREMELY STABLE COMPLEX OF CRAYFISH TRYPSIN WITH BOVINE TRYPSIN INHIBITOR
 
Authors :  T. Molnar, J. Voros, B. Szeder, K. Takats, J. Kardos, G. Katona, L. Graf
Date :  17 May 13  (Deposition) - 04 Sep 13  (Release) - 13 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,I,J
Biol. Unit 1:  B,J  (1x)
Biol. Unit 2:  A,I  (1x)
Keywords :  Hydolase-Inhibitor Complex, Protease, Inhibition, Arthropoda, Heat Stability, Complex Formation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Molnar, J. Voros, B. Szeder, K. Takats, J. Kardos, G. Katona, L. Graf
Comparison Of Complexes Formed By A Crustacean And A Vertebrate Trypsin With Bovine Pancreatic Trypsin Inhibitor - The Key To Achieving Extreme Stability?
Febs J. V. 280 5750 2013
PubMed-ID: 24034223  |  Reference-DOI: 10.1111/FEBS.12491

(-) Compounds

Molecule 1 - HEPATOPANCREAS TRYPSIN
    ChainsA, B
    EC Number3.4.21.4
    OrganSTOMACH
    Organism CommonNARROW-FINGERED CRAYFISH
    Organism ScientificPONTASTACUS LEPTODACTYLUS
    Organism Taxid6717
 
Molecule 2 - PANCREATIC TRYPSIN INHIBITOR
    ChainsI, J
    OrganPANCREAS
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymBOVINE PANCREATIC TRYPSIN INHIBITOR, APROTININ, BASIC PROTEASE INHIBITOR, BPI, BPTI

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABIJ
Biological Unit 1 (1x) B J
Biological Unit 2 (1x)A I 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric Unit (2, 6)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION
2SO42Ligand/IonSULFATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2SO41Ligand/IonSULFATE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2SO41Ligand/IonSULFATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:70 , ASP A:72 , VAL A:75 , GLU A:77 , GLU A:80 , HOH A:2088BINDING SITE FOR RESIDUE CA A 600
2AC2SOFTWAREASP A:165 , ASP A:178 , MET A:180 , GLU A:231 , HOH A:2175 , HOH A:2176BINDING SITE FOR RESIDUE CA A 601
3AC3SOFTWAREGLU B:70 , ASP B:72 , VAL B:75 , GLU B:77 , GLU B:80 , HOH B:2059BINDING SITE FOR RESIDUE CA B 600
4AC4SOFTWAREASP B:165 , ASP B:178 , MET B:180 , GLU B:231BINDING SITE FOR RESIDUE CA B 601
5AC5SOFTWAREPHE I:4 , ARG I:42 , HOH I:2005 , HOH I:2053 , HOH I:2065 , HOH I:2066 , HOH I:2067BINDING SITE FOR RESIDUE SO4 I 701
6AC6SOFTWAREHOH A:2116 , GLU J:7 , LYS J:41 , ARG J:42 , HOH J:2008BINDING SITE FOR RESIDUE SO4 J 701

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:42 -A:58
2A:168 -A:182
3A:191 -A:219
4B:42 -B:58
5B:168 -B:182
6B:191 -B:219
7I:5 -I:55
8I:14 -I:38
9I:30 -I:51
10J:5 -J:55
11J:14 -J:38
12J:30 -J:51

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4BNR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4BNR)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPTI_KUNITZ_2PS50279 Pancreatic trypsin inhibitor (Kunitz) family profile.BPT1_BOVIN40-90
 
  2I:5-55
J:5-55
2BPTI_KUNITZ_1PS00280 Pancreatic trypsin inhibitor (Kunitz) family signature.BPT1_BOVIN68-86
 
  2I:33-51
J:33-51
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPTI_KUNITZ_2PS50279 Pancreatic trypsin inhibitor (Kunitz) family profile.BPT1_BOVIN40-90
 
  1-
J:5-55
2BPTI_KUNITZ_1PS00280 Pancreatic trypsin inhibitor (Kunitz) family signature.BPT1_BOVIN68-86
 
  1-
J:33-51
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPTI_KUNITZ_2PS50279 Pancreatic trypsin inhibitor (Kunitz) family profile.BPT1_BOVIN40-90
 
  1I:5-55
-
2BPTI_KUNITZ_1PS00280 Pancreatic trypsin inhibitor (Kunitz) family signature.BPT1_BOVIN68-86
 
  1I:33-51
-

(-) Exons   (0, 0)

(no "Exon" information available for 4BNR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:237
 aligned with Q52V24_ASTLP | Q52V24 from UniProtKB/TrEMBL  Length:237

    Alignment length:237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       
        Q52V24_ASTLP      1 IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCAYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKANAV  237
               SCOP domains d4bnra_ A: Trypsin(ogen)                                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeeee..eeeeeeeeeeee..eeee...............eeeee............eeeeeeeeee.............eeeee........................eeeeee..............eeeeeeeehhhhhhhhhh.......eeee................eeee......eeeeeeee..........eeeee...hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4bnr A   16 IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCVYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKANAV  244
                                    25        35  |||   42        52       60B||||    66        76        86        96       106       116       126    || 138       148||     159       169    |  178      186B       196       206       216       227       237       
                                                37A||                     60A|||||                                                                    131|            149|                   173A          186A|                                    225|                 
                                                 37B|                      60B||||                                                                     134             151                                  186B                                     227                 
                                                  37C                       60C|||                                                                                                                                                                                       
                                                                             60D||                                                                                                                                                                                       
                                                                              60E|                                                                                                                                                                                       
                                                                               60F                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:237
 aligned with Q52V24_ASTLP | Q52V24 from UniProtKB/TrEMBL  Length:237

    Alignment length:237
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       
        Q52V24_ASTLP      1 IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCAYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKANAV  237
               SCOP domains d4bnrb_ B: Trypsin(ogen)                                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeeee..eeeeeeeeeeee..eeee...............eeeee............eeeeeeeeee.............eeeee........................eeeeee..............eeeeeeeehhhhhhhhhh.......eeee................eeee......eeeeeeee..........eeeee...hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4bnr B   16 IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCVYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKANAV  244
                                    25        35  |||   42        52       60B||||    66        76        86        96       106       116       126    || 138       148||     159       169    |  178      186B       196       206       216       227       237       
                                                37A||                     60A|||||                                                                    131|            149|                   173A          186A|                                    225|                 
                                                 37B|                      60B||||                                                                     134             151                                  186B                                     227                 
                                                  37C                       60C|||                                                                                                                                                                                       
                                                                             60D||                                                                                                                                                                                       
                                                                              60E|                                                                                                                                                                                       
                                                                               60F                                                                                                                                                                                       

Chain I from PDB  Type:PROTEIN  Length:59
 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot  Length:100

    Alignment length:59
                                    45        55        65        75        85         
          BPT1_BOVIN     36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAI   94
               SCOP domains d4bnri_ I: automated matches                                SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----BPTI_KUNITZ_2  PDB: I:5-55 UniProt: 40-90          ---- PROSITE (1)
                PROSITE (2) --------------------------------BPTI_KUNITZ_1      -------- PROSITE (2)
                 Transcript ----------------------------------------------------------- Transcript
                4bnr I    1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAI   59
                                    10        20        30        40        50         

Chain J from PDB  Type:PROTEIN  Length:59
 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot  Length:100

    Alignment length:59
                                    45        55        65        75        85         
          BPT1_BOVIN     36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAI   94
               SCOP domains d4bnrj_ J: automated matches                                SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----BPTI_KUNITZ_2  PDB: J:5-55 UniProt: 40-90          ---- PROSITE (1)
                PROSITE (2) --------------------------------BPTI_KUNITZ_1      -------- PROSITE (2)
                 Transcript ----------------------------------------------------------- Transcript
                4bnr J    1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAI   59
                                    10        20        30        40        50         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4BNR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4BNR)

(-) Gene Ontology  (15, 16)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q52V24_ASTLP | Q52V24)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Chain I,J   (BPT1_BOVIN | P00974)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0019870    potassium channel inhibitor activity    Stops, prevents, or reduces the activity of a potassium channel.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
    GO:0090331    negative regulation of platelet aggregation    Any process that decreases the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0070495    negative regulation of thrombin-activated receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of thrombin-activated receptor protein signaling pathway activity. A thrombin receptor signaling pathway is the series of molecular signals generated as a consequence of a thrombin-activated receptor binding to one of its physiological ligands.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4bnr)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4bnr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BPT1_BOVIN | P00974
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Q52V24_ASTLP | Q52V24
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BPT1_BOVIN | P00974
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q52V24_ASTLP | Q52V24
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BPT1_BOVIN | P009741aal 1b0c 1bhc 1bpi 1bpt 1brb 1bth 1bti 1bz5 1bzx 1cbw 1co7 1d0d 1eaw 1ejm 1f5r 1f7z 1fak 1fan 1fy8 1g6x 1jv8 1jv9 1k09 1k6u 1ld5 1ld6 1mtn 1nag 1oa5 1oa6 1p2i 1p2j 1p2k 1p2m 1p2n 1p2o 1p2q 1pit 1qlq 1t7c 1t8l 1t8m 1t8n 1t8o 1tpa 1uua 1uub 1ykt 1ylc 1yld 2fi3 2fi4 2fi5 2ftl 2ftm 2hex 2ijo 2kai 2ptc 2r9p 2ra3 2tgp 2tpi 2zjx 2zvx 3btd 3bte 3btf 3btg 3bth 3btk 3btm 3btq 3btt 3btw 3fp6 3fp7 3fp8 3gym 3ldi 3ldj 3ldm 3otj 3p92 3p95 3tgi 3tgj 3tgk 3tpi 3u1j 3wny 4dg4 4pti 4tpi 4wwy 4wxv 4y0y 4y0z 4y10 4y11 5jb4 5jb5 5jb6 5jb7 5pti 6pti 7pti 8pti 9pti
UniProtKB/TrEMBL
        Q52V24_ASTLP | Q52V242f91

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4BNR)