|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 4) Biological Unit 2 (1, 16) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (9, 9)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BTD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BTD) |
PROSITE Motifs (5, 5)
Asymmetric Unit (5, 5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain E from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:223 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 TRY1_BOVIN 24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d3btde_ E: Trypsin(ogen) SCOP domains CATH domains 3btdE01 3btdE02 E:28-120,E:233-244 Trypsin-like serine proteases 3btdE01 E:16-27,E:121-232 Trypsin-like serine proteases 3btdE02 - CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: E:16-243 UniProt: 24-244 -- PROSITE (1) PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) PROSITE (3) -----------------------------------TRYPSI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3) Transcript 1 (1) Exon 1.2 PDB: E:16-63 (gaps) UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: E:151-194 UniProt: 154-199 Exon 1.5 PDB: E:195-245 (gaps) Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.3 PDB: E:63-151 (gaps) UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 3btd E 16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 245 25 37 47 57 67| 78 88 98 108 118 |129|| 140 150 160 170 180 | 188 198 ||212 || 222 232 242 34| 67| 125| || 184A 188A 204| 217| | 37 69 127 || 209 219 | 130| 221A 132 Chain I from PDB Type:PROTEIN Length:56 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:56 47 57 67 77 87 BPT1_BOVIN 38 DFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA 93 SCOP domains d3btdi_ I: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 3btdI00 I:503-558 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (2) --BPTI_KUNITZ_2 PDB: I:505-555 UniProt: 40-90 --- PROSITE (2) PROSITE (3) ------------------------------BPTI_KUNITZ_1 ------- PROSITE (3) Transcript -------------------------------------------------------- Transcript 3btd I 503 DFCLEPPYTGPCDARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA 558 512 522 532 542 552
|
||||||||||||||||||||
SCOP Domains (2, 2)
Asymmetric Unit
|
CATH Domains (2, 3)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BTD) |
Gene Ontology (17, 19)|
Asymmetric Unit(hide GO term definitions) Chain E (TRY1_BOVIN | P00760)
Chain I (BPT1_BOVIN | P00974)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|