![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (2, 2)
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 1SMF) |
Asymmetric/Biological Unit (3, 3)
|
Asymmetric/Biological Unit (4, 4)
|
Asymmetric/Biological UnitChain E from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:223 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 TRY1_BOVIN 24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d1smfe_ E: Trypsin(ogen) SCOP domains CATH domains 1smfE01 1smfE02 E:28-120,E:233-245 Trypsin-like serine proteases 1smfE01 E:16-27,E:121-232 Trypsin-like serine proteases 1smfE02 CATH domains Pfam domains Trypsin-1smfE01 E:16-238 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: E:16-243 UniProt: 24-244 -- PROSITE (1) PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: E:16-63 (gaps) UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: E:151-194 UniProt: 154-199 Exon 1.5 PDB: E:195-245 (gaps) Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.3 PDB: E:63-151 (gaps) UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 1smf E 16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 245 25 37 47 57 67| 78 88 98 108 118 |129|| 140 150 160 170 180 | 188 198 ||212 || 222 232 242 34| 67| 125| || 184A 188A 204| 217| | 37 69 127 || 209 219 | 130| 221A 132 Chain I from PDB Type:PROTEIN Length:9 aligned with IBB_VIGRR | P01062 from UniProtKB/Swiss-Prot Length:72 Alignment length:9 IBB_VIGRR 18 CTKSIPPEC 26 SCOP domains d1smfi_ SCOP domains CATH domains --------- CATH domains Pfam domains Bowman-Bi Pfam domains SAPs(SNPs) --------- SAPs(SNPs) PROSITE --------- PROSITE Transcript --------- Transcript 1smf I 9 CTKSIPPEC 17
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit(hide GO term definitions) Chain E (TRY1_BOVIN | P00760)
Chain I (IBB_VIGRR | P01062)
|
|
|
|
|
|
|