|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric/Biological Unit (2, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (6, 6)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QBN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QBN) |
PROSITE Motifs (3, 3)
Asymmetric/Biological Unit (3, 3)
|
||||||||||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:223 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 TRY1_BOVIN 24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d1qbna_ A: Trypsin(ogen) SCOP domains CATH domains 1qbnA01 1qbnA02 A:19-108,A:217-229 Trypsin-like serine proteases 1qbnA01 A:7-18,A:109-216 Trypsin-like serine proteases 1qbnA02 CATH domains Pfam domains Trypsin-1qbnA01 A:7-222 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: A:7-227 UniProt: 24-244 -- PROSITE (1) PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: A:7-52 UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: A:137-182 UniProt: 154-199 Exon 1.5 PDB: A:183-229 UniProt: 200-248 Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.3 PDB: A:52-137 UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 1qbn A 7 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 229 16 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 176 186 196 206 216 226
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (10, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (TRY1_BOVIN | P00760)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|