2TPI - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   ON THE DISORDERED ACTIVATION DOMAIN IN TRYPSINOGEN. CHEMICAL LABELLING AND LOW-TEMPERATURE CRYSTALLOGRAPHY

Authors :   J. Walter, W. Steigemann, T. P. Singh, H. Bartunik, W. Bode, R. Huber

Date :   26 Oct 81 (Deposition) - 04 Mar 82 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : I,Z

Keywords :   Complex (Proteinase/Inhibitor), Hydrolase/Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Walter, W. Steigemann, T. P. Singh, H. Bartunik, W. Bode, R. Huber
On The Disordered Activation Domain In Trypsinogen. Chemical Labelling And Low-Temperature Crystallography
Acta Crystallogr. , Sect. B V. 38 1462 1982
PubMed: search
(for further references see the PDB file header)

Molecule 1 - TRYPSINOGEN
	Chains	:	Z
	EC Number	:	3.4.21.4
	Engineered	:	YES

Molecule 2 - TRYPSIN INHIBITOR
	Chains	:	I
	Organ	:	PANCREAS
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	BASIC PROTEASE INHIBITOR, APROTININ

		1	2
Asymmetric/Biological Unit	:	I	Z

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 3)

No.	Name	Count	Type	Full Name
1	HG	1	Ligand/Ion	MERCURY (II) ION
2	ILE	1	Mod. Amino Acid	ISOLEUCINE
3	VAL	1	Mod. Amino Acid	VALINE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY Z:19 , GLY Z:142 , ASN Z:143 , THR Z:144 , LYS Z:156 , LEU Z:158 , ASP Z:189 , CYS Z:191 , ASP Z:194 , HOH Z:429 , HOH Z:430 , VAL Z:1017	BINDING SITE FOR RESIDUE ILE Z 1016
2	AC2	SOFTWARE	HG Z:1 , GLY Z:19 , ASN Z:143 , THR Z:144 , LYS Z:188 , GLY Z:188A , ASP Z:189 , CYS Z:191 , CYS Z:220 , HOH Z:456 , ILE Z:1016	BINDING SITE FOR RESIDUE VAL Z 1017
3	AC3	SOFTWARE	ASN Z:143 , LYS Z:145 , SER Z:146 , CYS Z:191 , CYS Z:220 , HOH Z:596 , VAL Z:1017	BINDING SITE FOR RESIDUE HG Z 1

Asymmetric/Biological Unit

No.	Residues
1	I:5	-	I:55
2	I:14	-	I:38
3	I:30	-	I:51
4	Z:22	-	Z:157
5	Z:42	-	Z:58
6	Z:128	-	Z:232
7	Z:136	-	Z:201
8	Z:168	-	Z:182

(no "Cis Peptide Bond" information available for 2TPI)

(no "SAP(SNP)/Variant" information available for 2TPI)

Asymmetric/Biological Unit (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BPTI_KUNITZ_2	PS50279	Pancreatic trypsin inhibitor (Kunitz) family profile.	BPT1_BOVIN	40-90	1	I:5-55
2	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	Z:53-58
3	BPTI_KUNITZ_1	PS00280	Pancreatic trypsin inhibitor (Kunitz) family signature.	BPT1_BOVIN	68-86	1	I:33-51
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	Z:189-200

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000033479	1	ENSBTAE00000401279	chr4:109299627-109299547	81	TRY1_BOVIN	1-16	16	0	-	-
1.2	ENSBTAT00000033479	2	ENSBTAE00000397626	chr4:109298170-109298011	160	TRY1_BOVIN	16-69	54	1	Z:19-63 (gaps)	45
1.3	ENSBTAT00000033479	3	ENSBTAE00000409037	chr4:109297593-109297340	254	TRY1_BOVIN	69-154	86	1	Z:63-151 (gaps)	89
1.4	ENSBTAT00000033479	4	ENSBTAE00000386782	chr4:109296654-109296518	137	TRY1_BOVIN	154-199	46	1	Z:151-194	46
1.5	ENSBTAT00000033479	5	ENSBTAE00000422174	chr4:109295990-109295749	242	TRY1_BOVIN	200-248	49	1	Z:195-245 (gaps)	52

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain I from PDB  Type:PROTEIN  Length:57
 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot  Length:100

    Alignment length:57
                                    46        56        66        76        86       
          BPT1_BOVIN     37 PDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA   93
               SCOP domains d2tpii_ I: Pancreatic trypsin inhibitor, BPTI             SCOP domains
               CATH domains 2tpiI00 I:2-58 Factor Xa Inhibitor                        CATH domains
               Pfam domains --Kunitz_BPTI-2tpiI01 I:4-56                           -- Pfam domains
         Sec.struct. author ..............eeeeeeeeee..eeeeeeeee..........hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---BPTI_KUNITZ_2  PDB: I:5-55 UniProt: 40-90          --- PROSITE (1)
                PROSITE (2) -------------------------------BPTI_KUNITZ_1      ------- PROSITE (2)
                 Transcript --------------------------------------------------------- Transcript
                2tpi I    2 PDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA   58
                                    11        21        31        41        51

Chain Z from PDB  Type:PROTEIN  Length:222
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:222
                                                                                                                                                                                                                                                     246  
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246  
          TRY1_BOVIN     27 GYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN--    -
               SCOP domains d2tpiz_ Z: Trypsin(ogen)                                                                                                                                                                                                       SCOP domains
               CATH domains 2tpiZ01  2tpiZ02 Z:28-120,Z:233-245 Trypsin-like serine proteases                                  2tpiZ01 Z:19-27,Z:121-232 Trypsin-like serine proteases                                                     2tpiZ02      -- CATH domains
               Pfam domains Trypsin-2tpiZ01 Z:19-238                                                                                                                                                                                             --------- Pfam domains
         Sec.struct. author ............................................................................................................................................hhhhhhhhhhhhh...................................................hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) --------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: Z:19-63 (gaps) [INCOMPLETE] ------------------------------------------------------------------------------------Exon 1.4  PDB: Z:151-194 UniProt: 154-199     Exon 1.5  PDB: Z:195-245 (gaps)                -- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3  PDB: Z:63-151 (gaps) UniProt: 69-154                                        ---------------------------------------------------------------------------------------------- Transcript 1 (2)
                2tpi Z   19 GYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASNIV 1017
                                    28     || 40        50        60      ||71        81        91       101       111       121   ||  133       143       153       163       173       183|    | 191       201  ||   215 || |  225       235       245| 
                                          34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                      245| 
                                           37                             69                                                      127  ||                                                                        209      219 |                      1016 
                                                                                                                                     130|                                                                                  221A                           
                                                                                                                                      132

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Trypsin-like serine proteases (1752)

Superfamily: Trypsin-like serine proteases (1752)

Family: Eukaryotic proteases (1343)

Protein domain: Trypsin(ogen) (500)

Cow (Bos taurus) [TaxId: 9913] (392)

d2tpiz_

Class: Small proteins (3458)

Fold: BPTI-like (161)

Superfamily: BPTI-like (161)

Family: Small Kunitz-type inhibitors & BPTI-like toxins (128)

Protein domain: Pancreatic trypsin inhibitor, BPTI (85)

Cow (Bos taurus) [TaxId: 9913] (85)

d2tpii_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Few Secondary Structures (1120)

Architecture: Irregular (1120)

Topology: Factor Xa Inhibitor (116)

Homologous Superfamily: Factor Xa Inhibitor (116)

[unclassified] (5)

2tpiI00

I:2-58

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Thrombin, subunit H (1535)

Homologous Superfamily: Trypsin-like serine proteases (1488)

[unclassified] (24)

2a	2tpiZ01	Z:19-27,Z:121-232
2b	2tpiZ02	Z:28-120,Z:233-245

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Peptidase_PA (797)

Family: Trypsin (679)

Bos taurus (Bovine) (190)

Trypsin-2tpiZ01

Z:19-238

Clan: Protease_inhib (47)

Family: Kunitz_BPTI (45)

Bos taurus (Bovine) (33)

Kunitz_BPTI-2tpiI01

I:4-56

Asymmetric/Biological Unit(hide GO term definitions)

Chain I (BPT1_BOVIN | P00974)

molecular function
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0019870	potassium channel inhibitor activity	Stops, prevents, or reduces the activity of a potassium channel.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0090331	negative regulation of platelet aggregation	Any process that decreases the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0070495	negative regulation of thrombin-activated receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of thrombin-activated receptor protein signaling pathway activity. A thrombin receptor signaling pathway is the series of molecular signals generated as a consequence of a thrombin-activated receptor binding to one of its physiological ligands.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain Z (TRY1_BOVIN | P00760)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ILE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		VAL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2tpi)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2tpi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BPT1_BOVIN \| P00974
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TRY1_BOVIN \| P00760
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BPT1_BOVIN \| P00974
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TRY1_BOVIN \| P00760
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2TPI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (8, 8)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 4)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 3)

Pfam Domains (2, 2)

Gene Ontology (17, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File