Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
 
Authors :  J. Newman, T. S. Peat
Date :  08 Dec 11  (Deposition) - 08 Feb 12  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.25
Chains :  Asym./Biol. Unit :  A
Keywords :  Fragment Screening, Modelling, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Newman, O. Dolezal, V. Fazio, T. Caradoc-Davies, T. S. Peat
The Dingo Dataset: A Comprehensive Set Of Data For The Sampl Challenge.
J. Comput. Aided Mol. Des. V. 26 497 2012
PubMed-ID: 22187139  |  Reference-DOI: 10.1007/S10822-011-9521-2
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CATIONIC TRYPSIN
    ChainsA
    EC Number3.4.21.4
    OrganPANCREAS
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsSIGMA
    SynonymBETA-TRYPSIN, ALPHA-TRYPSIN CHAIN 1, ALPHA-TRYPSIN CHAIN 2

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 7)

Asymmetric/Biological Unit (5, 7)
No.NameCountTypeFull Name
1CA1Ligand/IonCALCIUM ION
2DMS1Ligand/IonDIMETHYL SULFOXIDE
3EDO3Ligand/Ion1,2-ETHANEDIOL
4K9S1Ligand/Ion1-(1-BENZOTHIOPHEN-3-YL)METHANAMINE
5SO41Ligand/IonSULFATE ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:169 , PRO A:173 , GLY A:174 , HOH A:2201 , HOH A:2277 , HOH A:2282 , HOH A:2291BINDING SITE FOR RESIDUE SO4 A1246
2AC2SOFTWAREGLU A:70 , ASN A:72 , VAL A:75 , GLU A:80 , HOH A:2118 , HOH A:2119BINDING SITE FOR RESIDUE CA A1247
3AC3SOFTWAREVAL A:76 , PHE A:82 , HOH A:2145 , HOH A:2147 , HOH A:2348 , HOH A:2349BINDING SITE FOR RESIDUE EDO A1248
4AC4SOFTWAREARG A:66 , ILE A:73 , ASN A:74 , VAL A:76 , HIS A:91 , PRO A:92 , HOH A:2119 , HOH A:2162BINDING SITE FOR RESIDUE EDO A1249
5AC5SOFTWARESER A:49 , ALA A:112 , SER A:113 , LEU A:114BINDING SITE FOR RESIDUE EDO A1250
6AC6SOFTWAREASN A:95 , SER A:96 , ASN A:97 , HOH A:2167 , HOH A:2349BINDING SITE FOR RESIDUE DMS A1251
7AC7SOFTWAREASP A:189 , SER A:190 , CYS A:191 , GLN A:192 , SER A:195 , GLY A:216 , GLY A:219 , GLY A:226 , HOH A:2311 , HOH A:2312BINDING SITE FOR RESIDUE K9S A1252

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:22 -A:157
2A:42 -A:58
3A:128 -A:232
4A:136 -A:201
5A:168 -A:182
6A:191 -A:220

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ABB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ABB)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY1_BOVIN24-244  1A:16-243
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY1_BOVIN59-64  1A:53-58
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.TRY1_BOVIN194-205  1A:189-200

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000334791ENSBTAE00000401279chr4:109299627-10929954781TRY1_BOVIN1-16160--
1.2ENSBTAT000000334792ENSBTAE00000397626chr4:109298170-109298011160TRY1_BOVIN16-69541A:16-63 (gaps)48
1.3ENSBTAT000000334793ENSBTAE00000409037chr4:109297593-109297340254TRY1_BOVIN69-154861A:63-151 (gaps)89
1.4ENSBTAT000000334794ENSBTAE00000386782chr4:109296654-109296518137TRY1_BOVIN154-199461A:151-19446
1.5ENSBTAT000000334795ENSBTAE00000422174chr4:109295990-109295749242TRY1_BOVIN200-248491A:195-245 (gaps)52

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d4abba_ A: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: A:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: A:151-194 UniProt: 154-199     Exon 1.5  PDB: A:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: A:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                4abb A   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                        
                                              37                             69                                                      127  ||                                                                        209      219  |                        
                                                                                                                                        130|                                                                                   221A                        
                                                                                                                                         132                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ABB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ABB)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (TRY1_BOVIN | P00760)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K9S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4abb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4abb
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRY1_BOVIN | P00760
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRY1_BOVIN | P00760
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRY1_BOVIN | P007601aq7 1auj 1az8 1bju 1bjv 1btp 1btw 1btx 1bty 1btz 1c1n 1c1o 1c1p 1c1q 1c1r 1c1s 1c1t 1c2d 1c2e 1c2f 1c2g 1c2h 1c2i 1c2j 1c2k 1c2l 1c2m 1c5p 1c5q 1c5r 1c5s 1c5t 1c5u 1c5v 1c9t 1ce5 1cu7 1cu8 1cu9 1d6r 1eb2 1ejm 1ezx 1f0t 1f0u 1f2s 1g36 1g3b 1g3c 1g3d 1g3e 1g9i 1gbt 1ghz 1gi0 1gi1 1gi2 1gi3 1gi4 1gi5 1gi6 1gj6 1hj9 1j8a 1jir 1jrs 1jrt 1k1i 1k1j 1k1l 1k1m 1k1n 1k1o 1k1p 1lqe 1max 1may 1mts 1mtu 1mtv 1mtw 1n6x 1n6y 1nc6 1ntp 1o2h 1o2i 1o2j 1o2k 1o2l 1o2m 1o2n 1o2o 1o2p 1o2q 1o2r 1o2s 1o2t 1o2u 1o2v 1o2w 1o2x 1o2y 1o2z 1o30 1o31 1o32 1o33 1o34 1o35 1o36 1o37 1o38 1o39 1o3a 1o3b 1o3c 1o3d 1o3e 1o3f 1o3g 1o3h 1o3i 1o3j 1o3k 1o3l 1o3m 1o3n 1o3o 1oph 1ox1 1oyq 1p2i 1p2j 1p2k 1ppc 1ppe 1pph 1qa0 1qb1 1qb6 1qb9 1qbn 1qbo 1qcp 1ql7 1ql8 1rxp 1s0q 1s0r 1sbw 1sfi 1smf 1tab 1taw 1tgb 1tgc 1tgn 1tgs 1tgt 1tio 1tld 1tng 1tnh 1tni 1tnj 1tnk 1tnl 1tpa 1tpo 1tpp 1tps 1tx7 1tx8 1tyn 1utn 1uto 1utp 1utq 1v2j 1v2k 1v2l 1v2m 1v2n 1v2o 1v2p 1v2q 1v2r 1v2s 1v2t 1v2u 1v2v 1v2w 1xuf 1xug 1xuh 1xui 1xuj 1xuk 1y3u 1y3v 1y3w 1y3x 1y3y 1y59 1y5a 1y5b 1y5u 1yp9 1yyy 1zr0 1zzz 2a7h 2age 2agg 2agi 2ah4 2ayw 2blv 2blw 2btc 2by5 2by6 2by7 2by8 2by9 2bya 2bza 2cmy 2d8w 2f3c 2fi3 2fi4 2fi5 2ftl 2ftm 2fx4 2fx6 2g55 2g5n 2g5v 2g81 2g8t 2iln 2j9n 2o9q 2otv 2oxs 2plx 2ptc 2ptn 2qn5 2qyi 2tga 2tgd 2tgp 2tgt 2tio 2tld 2tpi 2uuy 2xtt 2zdk 2zdl 2zdm 2zdn 2zfs 2zft 2zhd 2zq1 2zq2 3a7t 3a7v 3a7w 3a7x 3a7y 3a7z 3a80 3a81 3a82 3a83 3a84 3a85 3a86 3a87 3a88 3a89 3a8a 3a8b 3a8c 3a8d 3aas 3aau 3aav 3ati 3atk 3atl 3atm 3btd 3bte 3btf 3btg 3bth 3btk 3btm 3btq 3btt 3btw 3d65 3e8l 3gy2 3gy3 3gy4 3gy5 3gy6 3gy7 3gy8 3i29 3iti 3ljj 3ljo 3m35 3m7q 3mfj 3mi4 3nk8 3nkk 3otj 3plb 3plk 3plp 3pm3 3pmj 3ptb 3ptn 3pwb 3pwc 3pyh 3q00 3qk1 3rdz 3ru4 3rxa 3rxb 3rxc 3rxd 3rxe 3rxf 3rxg 3rxh 3rxi 3rxj 3rxk 3rxl 3rxm 3rxo 3rxp 3rxq 3rxr 3rxs 3rxt 3rxu 3rxv 3t25 3t26 3t27 3t28 3t29 3tpi 3unq 3unr 3uns 3uop 3upe 3uqo 3uqv 3uuz 3uwi 3uy9 3v0x 3v12 3v13 3veq 3vpk 4ab8 4ab9 4aba 4abd 4abe 4abf 4abg 4abh 4abi 4abj 4aoq 4aor 4b1t 4b2a 4b2b 4b2c 4gux 4hgc 4i8g 4i8h 4i8j 4i8k 4i8l 4j2y 4kts 4ktu 4mtb 4ncy 4niv 4niw 4nix 4niy 4tpi 4tpy 4u2w 4xoj 4y0y 4y0z 4y10 4y11 4yta 5eg4 5f6m 5fxl 5gib 5gxp 5jyi 5k7r 5lgo 5lh8 5mn1 5mna 5mnb 5mnc 5mnx 5mny 5mon 5moo 5ptp 5t3h

(-) Related Entries Specified in the PDB File

1aq7 TRYPSIN WITH INHIBITOR AERUGINOSIN 98-B
1auj BOVINE TRYPSIN COMPLEXED TO META-CYANO-BENZYLIC INHIBITOR
1az8 BOVINE TRYPSIN COMPLEXED TO BIS-PHENYLAMIDINE INHIBITOR
1bju BETA-TRYPSIN COMPLEXED WITH ACPU
1bjv BETA-TRYPSIN COMPLEXED WITH APPU
1btp MOL_ID: 1; MOLECULE: BETA-TRYPSIN; CHAIN: NULL; EC: 3 .4.21.4; HETEROGEN: N-[3-[4-[4-(AMIDINOPHENOXY)- CARBONYL]PHENYL]-2- METHYL-2-PROPENOYL]-N-ALLYLGLYCINE METHANESULFONATE
1btw MOL_ID: 1; MOLECULE: BETA-TRYPSIN; CHAIN: A; EC: 3.4 .21.4; MOL_ID: 2; MOLECULE: T-BUTOXY-ALA-VAL-BORO- LYS 1,3-PROPANEDIOL MONOESTER; CHAIN: H
1btx MOL_ID: 1; MOLECULE: BETA-TRYPSIN; CHAIN: A; EC: 3.4 .21.4; MOL_ID: 2; MOLECULE: T-BUTOXY-ALA-VAL-BORO- LYS ETHYL ESTER; CHAIN: H
1bty MOL_ID: 1; MOLECULE: BETA-TRYPSIN; CHAIN: NULL; EC: 3 .4.21.4; HETEROGEN: BENZAMIDINE
1btz MOL_ID: 1; MOLECULE: BETA-TRYPSIN; CHAIN: A; EC: 3.4 .21.4; MOL_ID: 2; MOLECULE: T-BUTOXY-ALA-VAL-BORO- LYS METHYL ESTER; CHAIN: H
1c1n RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1o RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1p RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1q RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1r RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1s RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c1t RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2d RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2e RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2f RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2g RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2h RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2i RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2j RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2k RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OFSERINE PROTEASES
1c2l RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c2m RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES
1c5p STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5q STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5r STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5s STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5t STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5u STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c5v STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR
1c9t COMPLEX OF BDELLASTASIN WITH BOVINE TRYPSIN
1ce5 BOVINE PANCREAS BETA-TRYPSIN IN COMPLEX WITH BENZAMIDINE
1cu7 BOVINE TRYPSIN COMPLEXED WITH 2-[3-AMINO(IMINOMETHYL) PHENOXY]-6-[3-(AMINOMETHYL)PHENOXY]-3,5-DIFLUORO-4- METHYLPYRIDINE (ZK-806299), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
1cu8 BOVINE TRYPSIN COMPLEXED WITH 2,6-BIS[3-AMINO(IMINO )METHYL PHENOXY]-3,5-DIFLUORO-4-METHYLPYRIDINE (ZK- 805623), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
1cu9 BOVINE TRYPSIN COMPLEXED WITH 2,6-BIS[3-AMINO(IMINO )METHYL PHENOXY]-3,5-DIFLUORO-4-METHYLPYRIDINE (ZK- 805623), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
1d6r CRYSTAL STRUCTURE OF CANCER CHEMOPREVENTIVE BOWMAN-BIRK INHIBITOR IN TERNARY COMPLEX WITH BOVINE TRYPSIN AT 2 .3 A RESOLUTION. STRUCTURAL BASIS OF JANUS-FACED SERINE PROTEASE INHIBITOR SPECIFICITY
1eb2 TRYPSIN INHIBITOR COMPLEX (FRA)
1ejm CRYSTAL STRUCTURE OF THE BPTI ALA16LEU MUTANT IN COMPLEX WITH BOVINE TRYPSIN
1ezx CRYSTAL STRUCTURE OF A SERPIN:PROTEASE COMPLEX
1f0t BOVINE TRYPSIN COMPLEXED WITH RPR131247
1f0u BOVINE TRYPSIN COMPLEXED WITH RPR128515
1f2s CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN BOVINE BETA- TRYPSIN AND MCTI-A, A TRYPSIN INHIBITOR OF SQUASH FAMILY AT 1.8 A RESOLUTION
1g36 TRYPSIN INHIBITOR COMPLEX
1g3b BOVINE BETA-TRYPSIN BOUND TO META-AMIDINO SCHIFF BASEMAGNESIUM(II) CHELATE
1g3c BOVINE BETA-TRYPSIN BOUND TO PARA-AMIDINO SCHIFF BASEIRON(III) CHELATE
1g3d BOVINE BETA-TRYPSIN BOUND TO META-AMIDINO SCHIFF BASECOPPER (II) CHELATE
1g3e BOVINE BETA-TRYPSIN BOUND TO PARA-AMIDINO SCHIFF- BASECOPPER (II) CHELATE
1g9i CRYSTAL STRUCTURE OF BETA-TRYSIN COMPLEX IN CYCLOHEXANE
1gbt BETA-TRYPSIN GUANIDINOBENZOYLATED AT SERINE 195 (PH 5. 5)
1ghz A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi0 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi1 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi2 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi3 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi4 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi5 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gi6 A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE
1gj6 ENGINEERING INHIBITORS HIGHLY SELECTIVE FOR THE S1 SITES OFSER190 TRYPSIN-LIKE SERINE PROTEASE DRUG TARGETS
1hj9 ATOMIC RESOLUTION STRUCTURES OF TRYPSIN PROVIDE INSIGHT INTO STRUCTURAL RADIATION DAMAGE
1j8a CRYSTAL STRUCTURE OF BENZAMIDINE INHIBITED BOVINEPANCREATIC TRYPSIN AT 105K TO 1.21A RESOLUTION FROMLABORATORY SOURCE WITH HIGH NUMBER OF WATERS MODELLED
1jir CRYSTAL STRUCTURE OF TRYPSIN COMPLEX WITH AMYLAMINE INCYCLOHEXANE
1jrs HEMIACETAL COMPLEX BETWEEN LEUPEPTIN AND TRYPSIN
1jrt HEMIACETAL COMPLEX BETWEEN LEUPEPTIN AND TRYPSIN
1k1i BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1j BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1l BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1m BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1n BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1o BOVINE TRYPSIN-INHIBITOR COMPLEX
1k1p BOVINE TRYPSIN-INHIBITOR COMPLEX
1lqe CRYSTAL STRUCTURE OF TRYPSIN IN COMPLEX WITH 79.
1max BETA-TRYPSIN PHOSPHONATE INHIBITED
1may BETA-TRYPSIN PHOSPHONATE INHIBITED
1mts FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1mtu FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1mtv FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1mtw FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1n6x RIP-PHASING ON BOVINE TRYPSIN
1n6y RIP-PHASING ON BOVINE TRYPSIN
1nc6 POTENT, SMALL MOLECULE INHIBITORS OF HUMAN MAST CELLTRYPTASE. ANTI-ASTHMATIC ACTION OF A DIPEPTIDE- BASEDTRANSITION STATE ANALOGUE CONTAINING BENZOTHIAZOLE KETONE
1ntp MODIFIED BETA TRYPSIN (MONOISOPROPYLPHOSPHORYL INHIBITED) ( NEUTRON DATA)
1o2h ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2i ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2j ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2k ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2l ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2m ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2n ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2o ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2p ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2q ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2r ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2s ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2t ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2u ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2v ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2w ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2x ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2y ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o2z ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o30 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o31 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o32 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o33 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o34 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o35 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o36 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o37 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o38 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o39 ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3a ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3b ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3c ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3d ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3e ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3f ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3g ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3h ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3i ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3j ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3k ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3l ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3m ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3n ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1o3o ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS
1oph NON-COVALENT COMPLEX BETWEEN ALPHA-1-PI-PITTSBURGH ANDS195A TRYPSIN
1ox1 CRYSTAL STRUCTURE OF THE BOVINE TRYPSIN COMPLEX WITH ASYNTHETIC 11 PEPTIDE INHIBITOR
1oyq TRYPSIN INHIBITOR COMPLEX
1p2i STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
1p2j STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
1p2k STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
1ppc TRYPSIN COMPLEX WITH NONCOVALENTLY BOUND NAPAP
1ppe TRYPSIN COMPLEX WITH (CUCURBITA MAXIMA) TRYPSIN INHIBITOR (CMTI-I)
1pph TRYPSIN COMPLEX WITH NONCOVALENTLY BOUND 3-TAPAP
1qa0 BOVINE TRYPSIN 2-AMINOBENZIMIDAZOLE COMPLEX
1qb1 BOVINE TRYPSIN WITH 1-[2-[5-[AMINO(IMINO)METHYL]-2 - HYDROXYPHENOXY]-6-[3-(4,5-DIHYDRO-1-METHYL-1H- IMIDAZOL-2-YL) PHENOXY]PYRIDIN-4-YL]PIPERIDINE-3- CARBOXYLIC ACID (ZK- 806974)
1qb6 BOVINE TRYPSIN 3,3'-[3,5-DIFLUORO-4-METHYL-2, 6- PYRIDINEDIYLBIS(OXY)]BIS(BENZENECARBOXIMIDAMIDE) (ZK-805623 ) COMPLEX
1qb9 BOVINE TRYPSIN 7-[[2-[[1-(1-IMINOETHYL)PIPERIDIN-4- YL]OXY]- 9H-CARBOZOL-9-YL] METHYL]NAPHTHALENE-2- CARBOXIMIDAMIDE (ZK- 806450) COMPLEX
1qbn BOVINE TRYPSIN 2-[AMINO(IMINO)METHYL]-2-HYDROXYPHENOXY ]-6- [3-(4,5-DIHYDRO-1H-IMIDAZOL-2-YL)PHENOXY] PYRIDINE-4- CARBOXYLIC ACID (ZK-806688) COMPLEX
1qbo BOVINE TRYPSIN 7-[[6-[[1-(1-IMINOETHYL)PIPERIDIN-4- YL]OXY]- 2-METHYL-BENZIMIDAZOL-1-YL]METHYL]NAPHTHALENE -2- CARBOXIMIDAMID ZK-806711 INHIBITOR COMPLEX
1qcp CRYSTAL STRUCTURE OF THE RWJ-51084 BOVINE PANCREATIC BETA- TRYPSIN AT 1.8 A
1ql7 FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1ql8 FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
1rxp STRUCTURE OF TRYPSIN (ORTHORHOMBIC) WITH 1-(4-TERT- BUTYLCARBAMOYL- PIPERAZINE-1-CARBONYL)-3-(3-GUANIDINO- PROPYL)-4-OXO-AZETIDINE-2-CARBOXYLIC ACID
1s0q NATIVE BOVINE PANCREATIC TRYPSIN
1s0r BOVINE PANCREATIC TRYPSIN INHIBITED WITH BENZAMIDINE ATATOMIC RESOLUTION
1sbw CRYSTAL STRUCTURE OF MUNG BEAN INHIBITOR LYSINE ACTIVE FRAGMENT COMPLEX WITH BOVINE BETA-TRYPSIN AT 1.8A RESOLUTION
1sfi HIGH RESOLUTION STRUCTURE OF A POTENT, CYCLIC PROTEASE INHIBITOR FROM SUNFLOWER SEEDS
1smf TRYPSIN COMPLEXED WITH BOWMAN-BIRK INHIBITOR
1tab TRYPSIN COMPLEX WITH BOWMAN-BIRK INHIBITOR (AB-I)
1taw BOVINE TRYPSIN COMPLEXED TO APPI
1tgb TRYPSINOGEN-CA FROM PEG
1tgc TRYPSINOGEN (0.50 METHANOL, 0.50 WATER)
1tgn TRYPSINOGEN
1tgs TRYPSINOGEN COMPLEX WITH PORCINE PANCREATIC SECRETORY TRYPSIN INHIBITOR
1tgt TRYPSINOGEN (173 DEGREES K, 0.70 METHANOL, 0.30 WATER)
1tio HIGH PACKING DENSITY FORM OF BOVINE BETA-TRYPSIN IN CYCLOHEXANE
1tld BETA-TRYPSIN (ORTHORHOMBIC) AT PH 5.3
1tng TRYPSIN COMPLEXED WITH THE INHIBITOR AMINOMETHYLCYCLOHEXANE
1tnh TRYPSIN COMPLEXED WITH THE INHIBITOR 4-FLUOROBENZYLAMINE
1tni TRYPSIN COMPLEXED WITH THE INHIBITOR 4-PHENYLBUTYLAMINE
1tnj TRYPSIN COMPLEXED WITH THE INHIBITOR 2-PHENYLETHYLAMINE
1tnk TRYPSIN COMPLEXED WITH THE INHIBITOR 3-PHENYLPROPYLAMINE
1tnl TRYPSIN COMPLEXED WITH THE INHIBITOR TRANYLCYPROMINE
1tpa ANHYDRO-TRYPSIN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR
1tpo BETA-TRYPSIN (ORTHORHOMBIC) AT PH5.0
1tpp BETA-TRYPSIN COMPLEX WITH P-AMIDINO-PHENYL-PYRUVATE ( APPA)
1tps TRYPSIN COMPLEXED WITH INHIBITOR A90720A
1tx7 BOVINE TRYPSIN COMPLEXED WITH P- AMIDINOPHENYLMETHYLPHOSPHINIC ACID (AMPA)
1tx8 BOVINE TRYPSIN COMPLEXED WITH AMSO
1tyn BETA TRYPSIN COMPLEXED WITH CYCLOTHEONAMIDE A
1utn TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS
1uto TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS
1utp TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS
1utq TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS
1v2j BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANT X( SSRI)BT.C1
1v2k FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSINVARIANT X(TRIPLE.GLU)BT.D2
1v2l BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX( TRIPLE.GLU)BT.D1
1v2m BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX( TRIPLE.GLU)BT.A1
1v2n POTENT FACTOR XA INHIBITOR IN COMPLEX WITH BOVINE TRYPSINVARIANT X(99/175/190)BT
1v2o TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSYI)BT.B4
1v2p TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSYI)BT.A4
1v2q TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSWI)BT.B4
1v2r TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSRI)BT.B4
1v2s BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSFI .GLU)BT.D1
1v2t TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSFI.GLU)BT.B4
1v2u BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARINAT X( SSAI)BT.D1
1v2v BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANT X( SSAI)BT.C1
1v2w TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSAI)BT.B4
1xuf TRYPSIN-BABIM-ZN+2, PH 8.2
1xug TRYPSIN-BABIM-ZN+2, PH 8.2
1xuh TRYPSIN-KETO-BABIM-CO+2, PH 8.2
1xui TRYPSIN-KETO-BABIM, ZN+2-FREE, PH 8.2
1xuj TRYPSIN-KETO-BABIM-ZN+2, PH 8.2
1xuk TRYPSIN-BABIM-SULFATE, PH 5.9
1y3u TRYPSIN INHIBITOR COMPLEX
1y3v TRYPSIN INHIBITOR COMPLEX
1y3w TRYPSIN INHIBITOR COMPLEX
1y3x TRYPSIN INHIBITOR COMPLEX
1y3y TRYPSIN INHIBITOR COMPLEX
1y59 DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT
1y5a DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT
1y5b DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT
1y5u DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT
1yp9 TRYPSIN INHIBITOR COMPLEX
1yyy TRYPSIN INHIBITORS WITH RIGID TRIPEPTIDYL ALDEHYDES
1zr0 CRYSTAL STRUCTURE OF KUNITZ DOMAIN 1 OF TISSUE FACTORPATHWAY INHIBITOR-2 WITH BOVINE TRYPSIN
1zzz TRYPSIN INHIBITORS WITH RIGID TRIPEPTIDYL ALDEHYDES
2a7h ON THE ROUTINE USE OF SOFT X-RAYS IN MACROMOLECULARCRYSTALLOGRAPHY, PART III- THE OPTIMAL DATA COLLECTIONWAVELENGTH
2ah4 GUANIDINOBENZOYL-TRYPSIN ACYL-ENZYME AT 1.13 A RESOLUTION
2ayw CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN TRYPSIN ANDA DESIGNED SYNTHETIC HIGHLY POTENT INHIBITOR IN THEPRESENCE OF BENZAMIDINE AT 0.97 A RESOLUTION
2blv TRYPSIN BEFORE A HIGH DOSE X-RAY "BURN"
2blw TRYPSIN AFTER A HIGH DOSE X-RAY "BURN"
2btc BOVINE TRYPSIN IN COMPLEX WITH SQUASH SEED INHIBITOR ( CUCURBITA PEPO TRYPSIN INHIBITOR II)
2by5 IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2by6 IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2by7 IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2by8 IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2by9 IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2bya IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION
2bza BOVINE PANCREAS BETA-TRYPSIN IN COMPLEX WITH BENZYLAMINE
2cmy CRYSTAL COMPLEX BETWEEN BOVINE TRYPSIN AND VERONICA HEDERIFOLIA TRYPSIN INHIBITOR
2fi3 CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS14->SER, CYS38 ->SER) IN COMPLEX WITH TRYPSIN
2fi4 CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS14->SER) IN COMPLEXWITH TRYPSIN
2fi5 CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS38->SER) IN COMPLEXWITH TRYPSIN
2ftl CRYSTAL STRUCTURE OF TRYPSIN COMPLEXED WITH BPTI AT 100K
2ftm CRYSTAL STRUCTURE OF TRYPSIN COMPLEXED WITH THE BPTIVARIANT (TYR35->GLY)
2fx4 BOVINE TRYPSIN BOUND BY 4-PIPERIDINEBUTYRATE TO MAKEACYLENZYME COMPLEX
2fx6 BOVINE TRYPSIN COMPLEXED WITH 2-AMINOBENZAMIDAZOLE
2j9n ROBOTICALLY HARVESTED TRYPSIN COMPLEXED WITH BENZAMIDINE CONTAINING POLYPEPTIDE MEDIATED CRYSTAL CONTACTS
2ptc BETA-TRYPSIN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR
2ptn TRYPSIN (ORTHORHOMBIC, 2.4 M AMMONIUM SULFATE)
2tga TRYPSINOGEN (2.4 M MAGNESIUM SULFATE)
2tgd TRYPSINOGEN, DIISOPROPYLPHOSPHORYL INHIBITED
2tgp TRYPSINOGEN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR
2tgt TRYPSINOGEN (103 DEGREES K, 0.70 METHANOL, 0.30 WATER)
2tio LOW PACKING DENSITY FORM OF BOVINE BETA-TRYPSIN IN CYCLOHEXANE
2tld BOVINE TRYPSIN COMPLEX WITH A MODIFIED SSI (STREPTOMYCES SUBTILISIN INHIBITOR) WITH MET 70 REPLACED BY GLY AND MET 73 REPLACED BY LYS (SSI(M70G,M73K))
2tpi TRYPSINOGEN - PANCREATIC TRYPSIN INHIBITOR - ILE-VAL COMPLEX (2.4 M MAGNESIUM SULFATE)
2uuy STRUCTURE OF A TICK TRYPTASE INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN
2xtt BOVINE TRYPSIN IN COMPLEX WITH EVOLUTIONARY ENHANCED SCHISTOCERCA GREGARIA PROTEASE INHIBITOR 1 (SGPI-1-P02)
3btd THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN THE BOVINE BETA-TRYPSIN AND TEN P1 VARIANTS OF BPTI.
3bte THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI.
3btf THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI.
3btg THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3bth THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3btk THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3btm THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3btq THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3btt THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3btw THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI
3ptb BETA-TRYPSIN (BENZAMIDINE INHIBITED) AT PH7
3ptn TRYPSIN (TRIGONAL, 2.4 M AMMONIUM SULFATE)
3tpi TRYPSINOGEN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR AND ILE-VAL
4ab8 FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4ab9 FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4aba FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4abd FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4abe FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4abf FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4abg FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4abh FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE
4tpi TRYPSINOGEN COMPLEX WITH THE ARG==15==-ANALOGUE OF PANCREATIC TRYPSIN INHIBITOR AND VAL-VAL
5ptp STRUCTURE OF HYDROLASE (SERINE PROTEINASE)