Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF 14-3-3ZETA IN COMPLEX WITH A CYCLIC PEPTIDE INVOLVING AN ADAMANTYL AND A DICARBOXY SIDE CHAIN
 
Authors :  D. Bier, D. Krueger, A. Glas, K. Wallraven, C. Ottmann, S. Hennig, T. Gro
Date :  28 Apr 16  (Deposition) - 10 May 17  (Release) - 10 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.34
Chains :  Asym./Biol. Unit :  A,B,D,E
Keywords :  Peptidomimetic, Ppi Inhibitor, Macrocycle, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Krueger, A. Glas, D. Bier, N. Pospiech, K. Wallraven, C. Ottmann, O. Koch, S. Hennig, T. Grossmann
Crystal Structure Of 14-3-3Zeta In Complex With A Cyclic Peptide Involving An Adamantyl And A Dicarboxy Side Chain
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 14-3-3 PROTEIN ZETA/DELTA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: YWHAZ
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PROTEIN KINASE C INHIBITOR PROTEIN 1,KCIP-1
 
Molecule 2 - GLN-GLY-MKD-ANG-ASP-MKD-LEU-ASP-LEU-ALA-CLU
    Chains: D, E
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 10)

Asymmetric/Biological Unit (4, 10)
No.NameCountTypeFull Name
16L92Mod. Amino Acid[(2S)-2,3-DIAMINO-3-OXOPROPYL]PROPANEDIOIC ACID
2A1G2Mod. Amino Acid(2S)-AMINO[(3R,5R,7R)-TRICYCLO[3.3.1.1~3,7~]DECAN-1-YL]ACETIC ACID
3BEZ2Ligand/IonBENZOIC ACID
4MKD4Mod. Amino Acid(2S)-2-AMINO-2-METHYLOCTANOIC ACID

(-) Sites  (31, 31)

Asymmetric Unit (31, 31)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
02AC2SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
03AC3SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
04AC4SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
05AC5SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
06AC6SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
07AC7SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
08AC8SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
09AC9SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
10AD1SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
11AD2SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
12AD3SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
13AD4SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
14AD5SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
15AD6SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
16AD7SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
17AD8SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
18AD9SOFTWAREPHE A:196 , GLN A:219 , ARG A:222 , PHE B:196 , ARG B:222binding site for residues BEZ A 301 and BEZ B 301
19AE1SOFTWAREPRO A:165 , ASP A:213 , GLN D:420 , A1G D:423 , ASP D:424 , MKD D:425 , LEU D:426 , HOH D:504binding site for Di-peptide GLY D 421 and MKD D 422
20AE2SOFTWAREPRO A:165 , ASP A:213 , GLN D:420 , GLY D:421 , ASP D:424 , MKD D:425 , LEU D:426 , LEU D:428 , HOH D:502binding site for residues MKD D 422 and A1G D 423
21AE3SOFTWARELYS A:49 , GLN D:420 , GLY D:421 , MKD D:422 , MKD D:425 , LEU D:426 , ASP D:427 , LEU D:428 , HOH D:502binding site for Di-peptide A1G D 423 and ASP D 424
22AE4SOFTWAREASN A:42 , SER A:45 , LYS A:49 , GLN D:420 , GLY D:421 , MKD D:422 , A1G D:423 , LEU D:426 , ASP D:427binding site for Di-peptide ASP D 424 and MKD D 425
23AE5SOFTWAREASN A:42 , SER A:45 , LYS A:120 , PRO A:165 , GLY D:421 , MKD D:422 , A1G D:423 , ASP D:424 , ASP D:427 , LEU D:428binding site for Di-peptide MKD D 425 and LEU D 426
24AE6SOFTWAREARG A:56 , ARG A:60 , ARG A:127 , ASN A:173 , VAL A:176 , LEU D:428 , HOH D:503binding site for Di-peptide ALA D 429 and 6L9 D 430
25AE7SOFTWAREPRO B:165 , ASP B:213 , GLN E:420 , A1G E:423 , ASP E:424 , MKD E:425 , LEU E:426binding site for Di-peptide GLY E 421 and MKD E 422
26AE8SOFTWAREASN B:42 , SER B:45 , VAL B:46 , PRO B:165 , ASP B:213 , GLY E:421 , A1G E:423 , ASP E:424 , LEU E:426 , ASP E:427binding site for residues MKD E 422 and MKD E 425
27AE9SOFTWAREPRO B:165 , ASP B:213 , ILE B:217 , GLY E:421 , ASP E:424 , MKD E:425 , LEU E:426 , LEU E:428 , HOH E:502binding site for residues MKD E 422 and A1G E 423
28AF1SOFTWARELYS B:49 , ASP B:213 , ILE B:217 , GLN E:420 , GLY E:421 , MKD E:422 , MKD E:425 , LEU E:426 , ASP E:427 , LEU E:428 , HOH E:501 , HOH E:502binding site for Di-peptide A1G E 423 and ASP E 424
29AF2SOFTWAREASN B:42 , SER B:45 , VAL B:46 , LYS B:49 , GLN E:420 , GLY E:421 , MKD E:422 , A1G E:423 , LEU E:426 , ASP E:427 , HOH E:501binding site for Di-peptide ASP E 424 and MKD E 425
30AF3SOFTWAREASN B:42 , SER B:45 , VAL B:46 , LYS B:120 , ILE B:217 , GLY E:421 , MKD E:422 , A1G E:423 , ASP E:424 , ASP E:427 , LEU E:428binding site for Di-peptide MKD E 425 and LEU E 426
31AF4SOFTWAREARG B:56 , ARG B:60 , ARG B:127 , ASN B:173 , VAL B:176 , LEU E:428 , HOH E:505binding site for Di-peptide ALA E 429 and 6L9 E 430

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JM4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JM4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JM4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JM4)

(-) Exons   (0, 0)

(no "Exon" information available for 5JM4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:228
                                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5jm4 A   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS 230
                                    11        21        31        41        51        61        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222        
                                                                                               70|                                                                                                                                                              
                                                                                                72                                                                                                                                                              


Chain B from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jm4 B   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSESYKDSTLIMQLLRDNLTLWTS 230
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200      |211       221         
                                                                                                                                                                                                                                        207|                     
                                                                                                                                                                                                                                         209                     


Chain D from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 5jm4 D 420 QGxxDxLDLAx 430
                              || | 429|
                            422-MKD   |
                             423-A1G  |
                               425-MKD|
                                    430-6L9


Chain E from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 5jm4 E 420 QGxxDxLDLAx 430
                              || | 429|
                              || |    |
                            422-MKD   |
                             423-A1G  |
                               425-MKD|
                                    430-6L9
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JM4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JM4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JM4)

(-) Gene Ontology  (27, 27)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6L9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    A1G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BEZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MKD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jm4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jm4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  1433Z_HUMAN | P63104
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  1433Z_HUMAN | P63104
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        1433Z_HUMAN | P63104: 1ib1 1qja 1qjb 2c1j 2c1n 2o02 2wh0 3cu8 3nkx 3rdh 4bg6 4fj3 4hkc 4ihl 4n7g 4n7y 4n84 4wrq 4zdr 5d2d 5d3f 5ewz 5exa 5j31 5jit 5jiv 5nas 5wxn

(-) Related Entries Specified in the PDB File

4n7g 4n84