1IB1 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE 14-3-3 ZETA:SEROTONIN N-ACETYLTRANSFERASE COMPLEX

Authors :   T. Obsil, R. Ghirlando, D. C. Klein, S. Ganguly, F. Dyda

Date :   26 Mar 01 (Deposition) - 02 May 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,B,E,F  (1x)
Biol. Unit 2: C,D,G,H  (1x)

Keywords :   N-Acetyl Transferase, 14-3-3, Signal Transduction, Protein- Protein Complex, Phosphorylation, Signaling Protein/Transferase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Obsil, R. Ghirlando, D. C. Klein, S. Ganguly, F. Dyda
Crystal Structure Of The 14-3-3Zeta:Serotonin N-Acetyltransferase Complex. A Role For Scaffolding In Enzyme Regulation.
Cell(Cambridge, Mass. ) V. 105 257 2001
PubMed-ID: 11336675 | Reference-DOI: 10.1016/S0092-8674(01)00316-6
(for further references see the PDB file header)

Molecule 1 - 14-3-3 ZETA ISOFORM
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET14B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	YWHAZ
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PROTEIN KINASE C INHIBITOR PROTEIN-1

Molecule 2 - SEROTONIN N-ACETYLTRANSFERASE
	Chains	:	E, F, G, H
	EC Number	:	2.3.1.87
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-4T-1
	Expression System Strain	:	BL21(DE3)PLYS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	AANAT OR SNAT
	Organism Common	:	SHEEP
	Organism Scientific	:	OVIS ARIES
	Organism Taxid	:	9940
	Synonym	:	ARALKYLAMINE N-ACETYLTRANSFERASE, AA-NAT, SEROTONIN ACETYLASE

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A	B			E	F
Biological Unit 2 (1x)	:			C	D			G	H

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 8)

No.	Name	Count	Type	Full Name
1	COT	4	Ligand/Ion	COA-S-ACETYL TRYPTAMINE
2	TPO	4	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	COT	2	Ligand/Ion	COA-S-ACETYL TRYPTAMINE
2	TPO	2	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	COT	2	Ligand/Ion	COA-S-ACETYL TRYPTAMINE
2	TPO	2	Mod. Amino Acid	PHOSPHOTHREONINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE F:56 , SER F:60 , CYS F:63 , PRO F:64 , HIS F:122 , ALA F:123 , LEU F:124 , ALA F:125 , VAL F:126 , ARG F:131 , GLN F:132 , GLN F:133 , GLY F:134 , GLY F:136 , SER F:137 , MET F:159 , CYS F:160 , GLU F:161 , ALA F:163 , LEU F:164 , PHE F:167 , TYR F:168 , ARG F:170 , PHE F:188 , HOH F:2129	BINDING SITE FOR RESIDUE COT F 400
2	AC2	SOFTWARE	PHE E:56 , SER E:60 , ASN E:62 , CYS E:63 , PRO E:64 , HIS E:122 , ALA E:123 , LEU E:124 , ALA E:125 , VAL E:126 , ARG E:131 , GLN E:132 , GLN E:133 , GLY E:134 , GLY E:136 , SER E:137 , MET E:159 , CYS E:160 , GLU E:161 , ALA E:163 , LEU E:164 , PHE E:167 , TYR E:168 , ARG E:170 , HOH E:3192 , HOH E:3491 , ARG G:115	BINDING SITE FOR RESIDUE COT E 401
3	AC3	SOFTWARE	ARG E:115 , PHE G:56 , SER G:60 , ASN G:62 , CYS G:63 , PRO G:64 , HIS G:122 , ALA G:123 , LEU G:124 , ALA G:125 , VAL G:126 , ARG G:131 , GLN G:132 , GLN G:133 , GLY G:134 , GLY G:136 , SER G:137 , MET G:159 , CYS G:160 , GLU G:161 , ALA G:163 , LEU G:164 , PHE G:167 , TYR G:168 , ARG G:170 , VAL G:183 , HOH G:2839	BINDING SITE FOR RESIDUE COT G 402
4	AC4	SOFTWARE	PHE H:56 , SER H:60 , CYS H:63 , PRO H:64 , HIS H:122 , ALA H:123 , LEU H:124 , ALA H:125 , VAL H:126 , ARG H:131 , GLN H:132 , GLN H:133 , GLY H:134 , GLY H:136 , SER H:137 , MET H:159 , CYS H:160 , GLU H:161 , ALA H:163 , LEU H:164 , PHE H:167 , TYR H:168 , ARG H:170 , VAL H:183 , PHE H:188 , HOH H:1431 , HOH H:1537 , HOH H:1655	BINDING SITE FOR RESIDUE COT H 403

(no "SS Bond" information available for 1IB1)

(no "Cis Peptide Bond" information available for 1IB1)

(no "SAP(SNP)/Variant" information available for 1IB1)

Asymmetric Unit (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	SNAT_SHEEP	35-196	4	E:35-196 F:35-196 G:35-196 H:35-196
2	1433_1	PS00796	14-3-3 proteins signature 1.	1433Z_HUMAN	41-51	4	A:41-51 B:41-51 C:41-51 D:41-51
3	1433_2	PS00797	14-3-3 proteins signature 2.	1433Z_HUMAN	211-230	4	A:211-228 B:211-228 C:211-228 D:211-228

Biological Unit 1 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	SNAT_SHEEP	35-196	2	E:35-196 F:35-196 - -
2	1433_1	PS00796	14-3-3 proteins signature 1.	1433Z_HUMAN	41-51	2	A:41-51 B:41-51 - -
3	1433_2	PS00797	14-3-3 proteins signature 2.	1433Z_HUMAN	211-230	2	A:211-228 B:211-228 - -

Biological Unit 2 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	SNAT_SHEEP	35-196	2	- - G:35-196 H:35-196
2	1433_1	PS00796	14-3-3 proteins signature 1.	1433Z_HUMAN	41-51	2	- - C:41-51 D:41-51
3	1433_2	PS00797	14-3-3 proteins signature 2.	1433Z_HUMAN	211-230	2	- - C:211-228 D:211-228

Asymmetric Unit (5, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3f	ENST00000395958	3f	ENSE00001523393	chr8:101964357-101964157	201	1433Z_HUMAN	-	0	0	-	-
1.8e	ENST00000395958	8e	ENSE00002177146	chr8:101961128-101960824	305	1433Z_HUMAN	1-98	98	4	A:2-98 B:2-98 C:2-98 D:2-98	97 97 97 97
1.12b	ENST00000395958	12b	ENSE00001088722	chr8:101937267-101937144	124	1433Z_HUMAN	99-140	42	4	A:99-140 B:99-140 C:99-140 D:99-140	42 42 42 42
1.13b	ENST00000395958	13b	ENSE00001088724	chr8:101936526-101936363	164	1433Z_HUMAN	140-194	55	4	A:140-194 B:140-194 C:140-194 D:140-194	55 55 55 55
1.13e	ENST00000395958	13e	ENSE00001756559	chr8:101936278-101936183	96	1433Z_HUMAN	195-226	32	4	A:195-226 B:195-226 C:195-226 D:195-226	32 32 32 32
1.14l	ENST00000395958	14l	ENSE00001693646	chr8:101932980-101930807	2174	1433Z_HUMAN	227-245	19	4	A:227-228 B:227-228 C:227-228 D:227-228	2 2 2 2

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:227
 aligned with 1433Z_HUMAN | P63104 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:227
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       
          1433Z_HUMAN     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1ib1a_ A: zeta isoform                                                                                                                                                                                                             SCOP domains
               CATH domains 1ib1A00 A:2-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------1433_1     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE (1)
           Transcript 1 (1) Exon 1.8e  PDB: A:2-98 UniProt: 1-98 [INCOMPLETE]                                                Exon 1.12b  PDB: A:99-140 UniProt: 99-140 ------------------------------------------------------Exon 1.13e  PDB: A:195-226      1. Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13b  PDB: A:140-194 UniProt: 140-194            ---------------------------------- Transcript 1 (2)
                 1ib1 A   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain B from PDB  Type:PROTEIN  Length:227
 aligned with 1433Z_HUMAN | P63104 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:227
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       
          1433Z_HUMAN     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1ib1b_ B: zeta isoform                                                                                                                                                                                                             SCOP domains
               CATH domains 1ib1B00 B:2-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------1433_1     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE (1)
           Transcript 1 (1) Exon 1.8e  PDB: B:2-98 UniProt: 1-98 [INCOMPLETE]                                                Exon 1.12b  PDB: B:99-140 UniProt: 99-140 ------------------------------------------------------Exon 1.13e  PDB: B:195-226      1. Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13b  PDB: B:140-194 UniProt: 140-194            ---------------------------------- Transcript 1 (2)
                 1ib1 B   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain C from PDB  Type:PROTEIN  Length:227
 aligned with 1433Z_HUMAN | P63104 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:227
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       
          1433Z_HUMAN     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1ib1c_ C: zeta isoform                                                                                                                                                                                                             SCOP domains
               CATH domains 1ib1C00 C:2-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------1433_1     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE (1)
           Transcript 1 (1) Exon 1.8e  PDB: C:2-98 UniProt: 1-98 [INCOMPLETE]                                                Exon 1.12b  PDB: C:99-140 UniProt: 99-140 ------------------------------------------------------Exon 1.13e  PDB: C:195-226      1. Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13b  PDB: C:140-194 UniProt: 140-194            ---------------------------------- Transcript 1 (2)
                 1ib1 C   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain D from PDB  Type:PROTEIN  Length:227
 aligned with 1433Z_HUMAN | P63104 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:227
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       
          1433Z_HUMAN     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1ib1d_ D: zeta isoform                                                                                                                                                                                                             SCOP domains
               CATH domains 1ib1D00 D:2-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------1433_1     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE (1)
           Transcript 1 (1) Exon 1.8e  PDB: D:2-98 UniProt: 1-98 [INCOMPLETE]                                                Exon 1.12b  PDB: D:99-140 UniProt: 99-140 ------------------------------------------------------Exon 1.13e  PDB: D:195-226      1. Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13b  PDB: D:140-194 UniProt: 140-194            ---------------------------------- Transcript 1 (2)
                 1ib1 D   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain E from PDB  Type:PROTEIN  Length:179
 aligned with SNAT_SHEEP | Q29495 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:179
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
           SNAT_SHEEP    18 SGIPGSPGRQRRHTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
               SCOP domains d1ib1e_ E: Serotonin N-acetyltranferase                                                                                                                                             SCOP domains
               CATH domains 1ib1E00 E:18-196  [code=3.40.630.30, no name defined]                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eee..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhheeeee..eeeeeeeeeee.....hhhhhhh......eeeeeeeee.hhhh..hhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhh...eeeee..........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------GNAT  PDB: E:35-196 UniProt: 35-196                                                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ib1 E  18 SGIPGSPGRQRRHtLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
                                    27   |    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
                                        31-TPO

Chain F from PDB  Type:PROTEIN  Length:179
 aligned with SNAT_SHEEP | Q29495 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:179
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
           SNAT_SHEEP    18 SGIPGSPGRQRRHTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
               SCOP domains d1ib1f_ F: Serotonin N-acetyltranferase                                                                                                                                             SCOP domains
               CATH domains 1ib1F00 F:18-196  [code=3.40.630.30, no name defined]                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eee..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhheeeee..eeeeeeeeeee.....hhhhhhh......eeeeeeeee.......hhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhh...eeeee..........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------GNAT  PDB: F:35-196 UniProt: 35-196                                                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ib1 F  18 SGIPGSPGRQRRHtLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
                                    27   |    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
                                        31-TPO

Chain G from PDB  Type:PROTEIN  Length:179
 aligned with SNAT_SHEEP | Q29495 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:179
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
           SNAT_SHEEP    18 SGIPGSPGRQRRHTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
               SCOP domains d1ib1g_ G: Serotonin N-acetyltranferase                                                                                                                                             SCOP domains
               CATH domains 1ib1G00 G:18-196  [code=3.40.630.30, no name defined]                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eee..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh...eeeeee..eeeeeeeeeee.....hhhhhhh......eeeeeeeee.hhhh..hhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhh...eeeee..........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------GNAT  PDB: G:35-196 UniProt: 35-196                                                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ib1 G  18 SGIPGSPGRQRRHtLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
                                    27   |    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
                                        31-TPO

Chain H from PDB  Type:PROTEIN  Length:179
 aligned with SNAT_SHEEP | Q29495 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:179
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
           SNAT_SHEEP    18 SGIPGSPGRQRRHTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
               SCOP domains d1ib1h_ H: Serotonin N-acetyltranferase                                                                                                                                             SCOP domains
               CATH domains 1ib1H00 H:18-196  [code=3.40.630.30, no name defined]                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eee..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhheeeee..eeeeeeeeeee.....hhhhhhh......eeeeeeeee.......hhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhh...eeeee..........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------GNAT  PDB: H:35-196 UniProt: 35-196                                                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ib1 H  18 SGIPGSPGRQRRHtLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR 196
                                    27   |    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187         
                                        31-TPO

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: 14-3-3 protein (60)

Family: 14-3-3 protein (60)

Protein domain: zeta isoform (10)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d1ib1a_	A:
1b	d1ib1b_	B:
1c	d1ib1c_	C:
1d	d1ib1d_	D:

Class: Alpha and beta proteins (a+b) (23004)

Fold: Acyl-CoA N-acyltransferases (Nat) (250)

Superfamily: Acyl-CoA N-acyltransferases (Nat) (250)

Family: N-acetyl transferase, NAT (154)

Protein domain: Serotonin N-acetyltranferase (7)

Sheep (Ovis aries) [TaxId: 9940] (7)

2a	d1ib1e_	E:
2b	d1ib1h_	H:
2c	d1ib1f_	F:
2d	d1ib1g_	G:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Aminopeptidase (284)

Homologous Superfamily: [code=3.40.630.30, no name defined] (126)

Human (Homo sapiens) (4)

1a	1ib1E00	E:18-196
1b	1ib1F00	F:18-196
1c	1ib1G00	G:18-196
1d	1ib1H00	H:18-196

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Delta-Endotoxin; domain 1 (33)

Homologous Superfamily: [code=1.20.190.20, no name defined] (28)

Human (Homo sapiens) (17)

2a	1ib1A00	A:2-228
2b	1ib1B00	B:2-228
2c	1ib1C00	C:2-228
2d	1ib1D00	D:2-228

(no "Pfam Domain" information available for 1IB1)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (1433Z_HUMAN | P63104)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0090168	Golgi reassembly	The reformation of the Golgi following its breakdown and partitioning contributing to Golgi inheritance.
	GO:0051683	establishment of Golgi localization	The directed movement of the Golgi to a specific location.
	GO:0061024	membrane organization	A process which results in the assembly, arrangement of constituent parts, or disassembly of a membrane. A membrane is a double layer of lipid molecules that encloses all cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway.
	GO:0006605	protein targeting	The process of targeting specific proteins to particular regions of the cell, typically membrane-bounded subcellular organelles. Usually requires an organelle specific protein sequence motif.
	GO:0010941	regulation of cell death	Any process that modulates the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0043488	regulation of mRNA stability	Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030659	cytoplasmic vesicle membrane	The lipid bilayer surrounding a cytoplasmic vesicle.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain E,F,G,H (SNAT_SHEEP | Q29495)

molecular function
	GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
	GO:0004059	aralkylamine N-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + an aralkylamine = CoA + an N-acetylaralkylamine.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0006474	N-terminal protein amino acid acetylation	The acetylation of the N-terminal amino acid of proteins.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0007623	circadian rhythm	Any biological process in an organism that recurs with a regularity of approximately 24 hours.
	GO:0030187	melatonin biosynthetic process	The chemical reactions and pathways resulting in the formation of melatonin (N-acetyl-5-methoxytryptamine).
	GO:0048511	rhythmic process	Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TPO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ib1)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ib1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	1433Z_HUMAN \| P63104
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SNAT_SHEEP \| Q29495
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.87
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	0092
		Age Related Information	:	GenAge
	0164
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	1433Z_HUMAN \| P63104
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SNAT_SHEEP \| Q29495
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1IB1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 12)

Exons (5, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (37, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File