Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SMALL-MOLECULE STABILIZATION OF THE 14-3-3/GAB2 PPI INTERFACE
 
Authors :  D. Bier, C. Ottmann
Date :  23 Nov 15  (Deposition) - 04 May 16  (Release) - 04 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  14-3-3, Gab2, Protein, Diphosphorylation, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Bier, M. Bartel, K. Sies, S. Halbach, Y. Higuchi, Y. Haranosono, T. Brummer, N. Kato, C. Ottmann
Small-Molecule Stabilization Of The 14-3-3/Gab2 Protein-Protein Interaction (Ppi) Interface.
Chemmedchem V. 11 911 2016
PubMed-ID: 26644359  |  Reference-DOI: 10.1002/CMDC.201500484

(-) Compounds

Molecule 1 - 14-3-3 PROTEIN ZETA/DELTA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: YWHAZ
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PROTEIN KINASE C INHIBITOR PROTEIN 1,KCIP-1
 
Molecule 2 - GRB2-ASSOCIATED-BINDING PROTEIN 2
    Chains: C, D
    Engineered: YES
    Fragment: UNP RESIDUES 387-395
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: GRB2-ASSOCIATED BINDER 2,GROWTH FACTOR RECEPTOR BOUND PROTEIN 2-ASSOCIATED PROTEIN 2,PP100
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
15SO2Ligand/IonFUSICOCCIN A-THF DERIVATIVE
2BEZ2Ligand/IonBENZOIC ACID
3MG1Ligand/IonMAGNESIUM ION
4TPO2Mod. Amino AcidPHOSPHOTHREONINE

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPHE A:117 , LYS A:120 , PRO A:165 , ASP A:213 , PRO D:393binding site for residue 5SO A 301
02AC2SOFTWAREGLN B:161 , PRO B:162 , THR B:163 , GLU B:202 , THR B:205binding site for residue MG B 301
03AC3SOFTWAREASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , ASP B:213 , LEU C:392 , PRO C:393binding site for residue 5SO B 302
04AC4SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
05AC5SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
06AC6SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
07AC7SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
08AC8SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
09AC9SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
10AD1SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
11AD2SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
12AD3SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
13AD4SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
14AD5SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
15AD6SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
16AD7SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
17AD8SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
18AD9SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
19AE1SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303
20AE2SOFTWAREPHE A:196 , MET A:218 , ARG A:222 , ASN B:42 , PHE B:117 , LYS B:120 , PRO B:165 , PHE B:196 , ASP B:213 , MET B:218 , ARG B:222 , LEU C:392 , PRO C:393binding site for residues BEZ A 302 and BEZ B 303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EXA)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Leu C:392 -Pro C:393
2Leu D:392 -Pro D:393

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EXA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EXA)

(-) Exons   (0, 0)

(no "Exon" information available for 5EXA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5exa A   2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS 230
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         


Chain B from PDB  Type:PROTEIN  Length:230
                                                                                                                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5exa B   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS 230
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230


Chain C from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5exa C 387 PRRNtLPAM 395
                                |    
                              391-TPO


Chain D from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ........... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 5exa D 387 PRRNtLPAMDQ 397
                                |  396 
                              391-TPO
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EXA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EXA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EXA)

(-) Gene Ontology  (38, 41)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5SO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BEZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu C:392 - Pro C:393   [ RasMol ]  
    Leu D:392 - Pro D:393   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5exa
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  1433Z_HUMAN | P63104
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  GAB2_HUMAN | Q9UQC2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  1433Z_HUMAN | P63104
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GAB2_HUMAN | Q9UQC2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        1433Z_HUMAN | P63104: 1ib1 1qja 1qjb 2c1j 2c1n 2o02 2wh0 3cu8 3nkx 3rdh 4bg6 4fj3 4hkc 4ihl 4n7g 4n7y 4n84 4wrq 4zdr 5d2d 5d3f 5ewz 5j31 5jit 5jiv 5jm4 5nas 5wxn
        GAB2_HUMAN | Q9UQC2: 2vwf 2w0z 5ewz

(-) Related Entries Specified in the PDB File

3cu8 4fj3 4ihl 4n7y