2Q6W - JenaLib

Asymmetric Unit (43, 86)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_060739	L	37	S	DRB3_HUMAN	Polymorphism	---	B/E	L	8	S
02	UniProt	VAR_060740	E	38	Q	DRB3_HUMAN	Polymorphism	1071747	B/E	E	9	Q
03	UniProt	VAR_060741	L	39	Y	DRB3_HUMAN	Polymorphism	---	B/E	L	10	Y
04	UniProt	VAR_016686	R	40	C	DRB3_HUMAN	Polymorphism	---	B/E	R	11	C
05	UniProt	VAR_060742	R	40	L	DRB3_HUMAN	Polymorphism	1071748	B/E	R	11	L
06	UniProt	VAR_060743	R	40	S	DRB3_HUMAN	Polymorphism	1136752	B/E	R	11	S
07	UniProt	VAR_060744	K	41	T	DRB3_HUMAN	Polymorphism	200581589	B/E	K	12	T
08	UniProt	VAR_060746	Y	55	F	DRB3_HUMAN	Polymorphism	147440497	B/E	Y	26	F
09	UniProt	VAR_060745	Y	55	L	DRB3_HUMAN	Polymorphism	---	B/E	Y	26	L
10	UniProt	VAR_060747	D	57	E	DRB3_HUMAN	Polymorphism	202185589	B/E	D	28	E
11	UniProt	VAR_060748	D	57	N	DRB3_HUMAN	Polymorphism	142793258	B/E	D	28	N
12	UniProt	VAR_060749	R	58	I	DRB3_HUMAN	Polymorphism	---	B/E	R	29	I
13	UniProt	VAR_060750	Y	59	H	DRB3_HUMAN	Polymorphism	138849995	B/E	Y	30	H
14	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	C/F	L	33	P
15	UniProt	VAR_060752	F	66	L	DRB3_HUMAN	Polymorphism	707956	B/E	F	37	L
16	UniProt	VAR_060753	F	66	N	DRB3_HUMAN	Polymorphism	---	B/E	F	37	N
17	UniProt	VAR_060751	F	66	S	DRB3_HUMAN	Polymorphism	200042906	B/E	F	37	S
18	UniProt	VAR_060754	F	66	Y	DRB3_HUMAN	Polymorphism	200042906	B/E	F	37	Y
19	UniProt	VAR_060755	L	67	A	DRB3_HUMAN	Polymorphism	---	B/E	L	38	A
20	UniProt	VAR_060756	L	67	V	DRB3_HUMAN	Polymorphism	1059580	B/E	L	38	V
21	UniProt	VAR_060757	R	68	S	DRB3_HUMAN	Polymorphism	774894415	B/E	R	39	S
22	UniProt	VAR_060758	T	80	R	DRB3_HUMAN	Polymorphism	79606458	B/E	T	51	R
23	UniProt	VAR_060759	R	84	L	DRB3_HUMAN	Polymorphism	---	B/E	R	55	L
24	UniProt	VAR_060760	V	86	A	DRB3_HUMAN	Polymorphism	144532965	B/E	V	57	A
25	UniProt	VAR_060762	V	86	D	DRB3_HUMAN	Polymorphism	144532965	B/E	V	57	D
26	UniProt	VAR_060761	V	86	S	DRB3_HUMAN	Polymorphism	---	B/E	V	57	S
27	UniProt	VAR_060763	A	87	E	DRB3_HUMAN	Polymorphism	---	B/E	A	58	E
28	UniProt	VAR_060764	S	89	H	DRB3_HUMAN	Polymorphism	---	B/E	S	60	H
29	UniProt	VAR_060765	S	89	Y	DRB3_HUMAN	Polymorphism	41541218	B/E	S	60	Y
30	UniProt	VAR_060766	L	96	F	DRB3_HUMAN	Polymorphism	41562819	B/E	L	67	F
31	UniProt	VAR_060767	L	96	I	DRB3_HUMAN	Polymorphism	41562819	B/E	L	67	I
32	UniProt	VAR_033396	G	102	A	DRB3_HUMAN	Polymorphism	17878857	B/E	G	73	A
33	UniProt	VAR_060768	R	103	Q	DRB3_HUMAN	Polymorphism	1059598	B/E	R	74	Q
34	UniProt	VAR_060769	N	106	T	DRB3_HUMAN	Polymorphism	115817940	B/E	N	77	T
35	UniProt	VAR_060770	G	113	R	DRB3_HUMAN	Polymorphism	---	B/E	G	84	R
36	UniProt	VAR_033397	V	114	A	DRB3_HUMAN	Polymorphism	1136778	B/E	V	85	A
37	UniProt	VAR_060771	G	115	A	DRB3_HUMAN	Polymorphism	---	B/E	G	86	A
38	UniProt	VAR_060772	G	115	V	DRB3_HUMAN	Polymorphism	41556512	B/E	G	86	V
39	UniProt	VAR_060773	A	169	T	DRB3_HUMAN	Polymorphism	75709987	B/E	A	140	T
40	UniProt	VAR_060774	Q	178	H	DRB3_HUMAN	Polymorphism	139485758	B/E	Q	149	H
41	UniProt	VAR_060775	V	193	F	DRB3_HUMAN	Polymorphism	---	B/E	V	164	F
42	UniProt	VAR_060776	A	212	P	DRB3_HUMAN	Polymorphism	142204283	B/E	A	183	P
43	UniProt	VAR_060777	R	218	S	DRB3_HUMAN	Polymorphism	147669022	B/E	R	189	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (43, 43)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_060739	L	37	S	DRB3_HUMAN	Polymorphism	---	B	L	8	S
02	UniProt	VAR_060740	E	38	Q	DRB3_HUMAN	Polymorphism	1071747	B	E	9	Q
03	UniProt	VAR_060741	L	39	Y	DRB3_HUMAN	Polymorphism	---	B	L	10	Y
04	UniProt	VAR_016686	R	40	C	DRB3_HUMAN	Polymorphism	---	B	R	11	C
05	UniProt	VAR_060742	R	40	L	DRB3_HUMAN	Polymorphism	1071748	B	R	11	L
06	UniProt	VAR_060743	R	40	S	DRB3_HUMAN	Polymorphism	1136752	B	R	11	S
07	UniProt	VAR_060744	K	41	T	DRB3_HUMAN	Polymorphism	200581589	B	K	12	T
08	UniProt	VAR_060746	Y	55	F	DRB3_HUMAN	Polymorphism	147440497	B	Y	26	F
09	UniProt	VAR_060745	Y	55	L	DRB3_HUMAN	Polymorphism	---	B	Y	26	L
10	UniProt	VAR_060747	D	57	E	DRB3_HUMAN	Polymorphism	202185589	B	D	28	E
11	UniProt	VAR_060748	D	57	N	DRB3_HUMAN	Polymorphism	142793258	B	D	28	N
12	UniProt	VAR_060749	R	58	I	DRB3_HUMAN	Polymorphism	---	B	R	29	I
13	UniProt	VAR_060750	Y	59	H	DRB3_HUMAN	Polymorphism	138849995	B	Y	30	H
14	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	C	L	33	P
15	UniProt	VAR_060752	F	66	L	DRB3_HUMAN	Polymorphism	707956	B	F	37	L
16	UniProt	VAR_060753	F	66	N	DRB3_HUMAN	Polymorphism	---	B	F	37	N
17	UniProt	VAR_060751	F	66	S	DRB3_HUMAN	Polymorphism	200042906	B	F	37	S
18	UniProt	VAR_060754	F	66	Y	DRB3_HUMAN	Polymorphism	200042906	B	F	37	Y
19	UniProt	VAR_060755	L	67	A	DRB3_HUMAN	Polymorphism	---	B	L	38	A
20	UniProt	VAR_060756	L	67	V	DRB3_HUMAN	Polymorphism	1059580	B	L	38	V
21	UniProt	VAR_060757	R	68	S	DRB3_HUMAN	Polymorphism	774894415	B	R	39	S
22	UniProt	VAR_060758	T	80	R	DRB3_HUMAN	Polymorphism	79606458	B	T	51	R
23	UniProt	VAR_060759	R	84	L	DRB3_HUMAN	Polymorphism	---	B	R	55	L
24	UniProt	VAR_060760	V	86	A	DRB3_HUMAN	Polymorphism	144532965	B	V	57	A
25	UniProt	VAR_060762	V	86	D	DRB3_HUMAN	Polymorphism	144532965	B	V	57	D
26	UniProt	VAR_060761	V	86	S	DRB3_HUMAN	Polymorphism	---	B	V	57	S
27	UniProt	VAR_060763	A	87	E	DRB3_HUMAN	Polymorphism	---	B	A	58	E
28	UniProt	VAR_060764	S	89	H	DRB3_HUMAN	Polymorphism	---	B	S	60	H
29	UniProt	VAR_060765	S	89	Y	DRB3_HUMAN	Polymorphism	41541218	B	S	60	Y
30	UniProt	VAR_060766	L	96	F	DRB3_HUMAN	Polymorphism	41562819	B	L	67	F
31	UniProt	VAR_060767	L	96	I	DRB3_HUMAN	Polymorphism	41562819	B	L	67	I
32	UniProt	VAR_033396	G	102	A	DRB3_HUMAN	Polymorphism	17878857	B	G	73	A
33	UniProt	VAR_060768	R	103	Q	DRB3_HUMAN	Polymorphism	1059598	B	R	74	Q
34	UniProt	VAR_060769	N	106	T	DRB3_HUMAN	Polymorphism	115817940	B	N	77	T
35	UniProt	VAR_060770	G	113	R	DRB3_HUMAN	Polymorphism	---	B	G	84	R
36	UniProt	VAR_033397	V	114	A	DRB3_HUMAN	Polymorphism	1136778	B	V	85	A
37	UniProt	VAR_060771	G	115	A	DRB3_HUMAN	Polymorphism	---	B	G	86	A
38	UniProt	VAR_060772	G	115	V	DRB3_HUMAN	Polymorphism	41556512	B	G	86	V
39	UniProt	VAR_060773	A	169	T	DRB3_HUMAN	Polymorphism	75709987	B	A	140	T
40	UniProt	VAR_060774	Q	178	H	DRB3_HUMAN	Polymorphism	139485758	B	Q	149	H
41	UniProt	VAR_060775	V	193	F	DRB3_HUMAN	Polymorphism	---	B	V	164	F
42	UniProt	VAR_060776	A	212	P	DRB3_HUMAN	Polymorphism	142204283	B	A	183	P
43	UniProt	VAR_060777	R	218	S	DRB3_HUMAN	Polymorphism	147669022	B	R	189	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (43, 43)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_060739	L	37	S	DRB3_HUMAN	Polymorphism	---	E	L	8	S
02	UniProt	VAR_060740	E	38	Q	DRB3_HUMAN	Polymorphism	1071747	E	E	9	Q
03	UniProt	VAR_060741	L	39	Y	DRB3_HUMAN	Polymorphism	---	E	L	10	Y
04	UniProt	VAR_016686	R	40	C	DRB3_HUMAN	Polymorphism	---	E	R	11	C
05	UniProt	VAR_060742	R	40	L	DRB3_HUMAN	Polymorphism	1071748	E	R	11	L
06	UniProt	VAR_060743	R	40	S	DRB3_HUMAN	Polymorphism	1136752	E	R	11	S
07	UniProt	VAR_060744	K	41	T	DRB3_HUMAN	Polymorphism	200581589	E	K	12	T
08	UniProt	VAR_060746	Y	55	F	DRB3_HUMAN	Polymorphism	147440497	E	Y	26	F
09	UniProt	VAR_060745	Y	55	L	DRB3_HUMAN	Polymorphism	---	E	Y	26	L
10	UniProt	VAR_060747	D	57	E	DRB3_HUMAN	Polymorphism	202185589	E	D	28	E
11	UniProt	VAR_060748	D	57	N	DRB3_HUMAN	Polymorphism	142793258	E	D	28	N
12	UniProt	VAR_060749	R	58	I	DRB3_HUMAN	Polymorphism	---	E	R	29	I
13	UniProt	VAR_060750	Y	59	H	DRB3_HUMAN	Polymorphism	138849995	E	Y	30	H
14	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	F	L	33	P
15	UniProt	VAR_060752	F	66	L	DRB3_HUMAN	Polymorphism	707956	E	F	37	L
16	UniProt	VAR_060753	F	66	N	DRB3_HUMAN	Polymorphism	---	E	F	37	N
17	UniProt	VAR_060751	F	66	S	DRB3_HUMAN	Polymorphism	200042906	E	F	37	S
18	UniProt	VAR_060754	F	66	Y	DRB3_HUMAN	Polymorphism	200042906	E	F	37	Y
19	UniProt	VAR_060755	L	67	A	DRB3_HUMAN	Polymorphism	---	E	L	38	A
20	UniProt	VAR_060756	L	67	V	DRB3_HUMAN	Polymorphism	1059580	E	L	38	V
21	UniProt	VAR_060757	R	68	S	DRB3_HUMAN	Polymorphism	774894415	E	R	39	S
22	UniProt	VAR_060758	T	80	R	DRB3_HUMAN	Polymorphism	79606458	E	T	51	R
23	UniProt	VAR_060759	R	84	L	DRB3_HUMAN	Polymorphism	---	E	R	55	L
24	UniProt	VAR_060760	V	86	A	DRB3_HUMAN	Polymorphism	144532965	E	V	57	A
25	UniProt	VAR_060762	V	86	D	DRB3_HUMAN	Polymorphism	144532965	E	V	57	D
26	UniProt	VAR_060761	V	86	S	DRB3_HUMAN	Polymorphism	---	E	V	57	S
27	UniProt	VAR_060763	A	87	E	DRB3_HUMAN	Polymorphism	---	E	A	58	E
28	UniProt	VAR_060764	S	89	H	DRB3_HUMAN	Polymorphism	---	E	S	60	H
29	UniProt	VAR_060765	S	89	Y	DRB3_HUMAN	Polymorphism	41541218	E	S	60	Y
30	UniProt	VAR_060766	L	96	F	DRB3_HUMAN	Polymorphism	41562819	E	L	67	F
31	UniProt	VAR_060767	L	96	I	DRB3_HUMAN	Polymorphism	41562819	E	L	67	I
32	UniProt	VAR_033396	G	102	A	DRB3_HUMAN	Polymorphism	17878857	E	G	73	A
33	UniProt	VAR_060768	R	103	Q	DRB3_HUMAN	Polymorphism	1059598	E	R	74	Q
34	UniProt	VAR_060769	N	106	T	DRB3_HUMAN	Polymorphism	115817940	E	N	77	T
35	UniProt	VAR_060770	G	113	R	DRB3_HUMAN	Polymorphism	---	E	G	84	R
36	UniProt	VAR_033397	V	114	A	DRB3_HUMAN	Polymorphism	1136778	E	V	85	A
37	UniProt	VAR_060771	G	115	A	DRB3_HUMAN	Polymorphism	---	E	G	86	A
38	UniProt	VAR_060772	G	115	V	DRB3_HUMAN	Polymorphism	41556512	E	G	86	V
39	UniProt	VAR_060773	A	169	T	DRB3_HUMAN	Polymorphism	75709987	E	A	140	T
40	UniProt	VAR_060774	Q	178	H	DRB3_HUMAN	Polymorphism	139485758	E	Q	149	H
41	UniProt	VAR_060775	V	193	F	DRB3_HUMAN	Polymorphism	---	E	V	164	F
42	UniProt	VAR_060776	A	212	P	DRB3_HUMAN	Polymorphism	142204283	E	A	183	P
43	UniProt	VAR_060777	R	218	S	DRB3_HUMAN	Polymorphism	147669022	E	R	189	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 4)

Exons (8, 16)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
 aligned with DRA_HUMAN | P01903 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:180
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207
            DRA_HUMAN    28 EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 207
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2q6wA01 A:3-81                                                                 2q6wA02 A:82-182 Immunoglobulins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeeeeee...eeeeeeee..eeeeeee....eeee...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee....ee...ee.....eeeeeeeee.......eeeeee.......eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC --------------- PROSITE
           Transcript 2 (1) 2---------------------------------------------------------------------------------Exon 2.8c  PDB: A:85-179 UniProt: 110-204                                                      --- Transcript 2 (1)
           Transcript 2 (2) Exon 2.7b  PDB: A:3-85 UniProt: 28-110                                             ---------------------------------------------------------------------------------------------2.9a Transcript 2 (2)
                 2q6w A   3 EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 182
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Chain B from PDB  Type:PROTEIN  Length:188
 aligned with DRB3_HUMAN | P79483 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:188
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211        
           DRB3_HUMAN    32 TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA 219
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2q6wB01 B:3-93 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1        2q6wB02 B:94-190 Immunoglobulins                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeeeee....eeeeeeeeee..eeeeeee.....eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeee......eeeeeee.......eeeeee. Sec.struct. author
             SAPs(SNPs) (1) -----SQYCT-------------F-EIH------LAS-----------R---L-AE-H------F-----AQ--T------RAA-----------------------------------------------------T--------H--------------F------------------P-----S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------L--------------L-N--------NV------------------D--Y------I------------------V-------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------S-------------------------S-------------------S------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----------------------------------Y--------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
           Transcript 1 (1) 1.2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1. Transcript 1 (1)
           Transcript 1 (2) --Exon 1.8  PDB: B:5-95 UniProt: 34-124                                                      ----------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------------------------------------------------------------------------------Exon 1.9  PDB: B:95-189 UniProt: 124-218                                                       - Transcript 1 (3)
                 2q6w B   3 TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA 190
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Chain C from PDB  Type:PROTEIN  Length:11
 aligned with ITB3_HUMAN | P05106 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:11
                                    59 
           ITB3_HUMAN    50 AWCSDEALPLG  60
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ........... Sec.struct. author
                 SAPs(SNPs) ---------P- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 2q6w C  24 AWRSDEALPLG  34
                                    33

Chain D from PDB  Type:PROTEIN  Length:180
 aligned with DRA_HUMAN | P01903 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:180
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207
            DRA_HUMAN    28 EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 207
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2q6wD01 D:3-81                                                                 2q6wD02 D:82-182 Immunoglobulins                                                                      CATH domains
           Pfam domains (1) -MHC_II_alpha-2q6wD03 D:4-84                                                      --------C1-set-2q6wD01 D:93-175                                                            ------- Pfam domains (1)
           Pfam domains (2) -MHC_II_alpha-2q6wD04 D:4-84                                                      --------C1-set-2q6wD02 D:93-175                                                            ------- Pfam domains (2)
         Sec.struct. author ..eeeeeeeeeee...eeeeeeee..eeeeeee....eeee...hhhhh...hhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee....ee...ee.....eeeeeeeee......eeeeeee.......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC --------------- PROSITE
           Transcript 2 (1) 2---------------------------------------------------------------------------------Exon 2.8c  PDB: D:85-179 UniProt: 110-204                                                      --- Transcript 2 (1)
           Transcript 2 (2) Exon 2.7b  PDB: D:3-85 UniProt: 28-110                                             ---------------------------------------------------------------------------------------------2.9a Transcript 2 (2)
                 2q6w D   3 EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 182
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Chain E from PDB  Type:PROTEIN  Length:188
 aligned with DRB3_HUMAN | P79483 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:188
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211        
           DRB3_HUMAN    32 TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA 219
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2q6wE01 E:3-93 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1        2q6wE02 E:94-190 Immunoglobulins                                                                  CATH domains
           Pfam domains (1) ----------MHC_II_beta-2q6wE03 E:13-87                                                ---------------C1-set-2q6wE01 E:103-190                                                                 Pfam domains (1)
           Pfam domains (2) ----------MHC_II_beta-2q6wE04 E:13-87                                                ---------------C1-set-2q6wE02 E:103-190                                                                 Pfam domains (2)
         Sec.struct. author ....eeeeeeeeeeee....eeeeeeeeee..eeeeeee.....eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeee....ee...eee...ee.....eeeeeeeee......eeeeeee.......eeeeee. Sec.struct. author
             SAPs(SNPs) (1) -----SQYCT-------------F-EIH------LAS-----------R---L-AE-H------F-----AQ--T------RAA-----------------------------------------------------T--------H--------------F------------------P-----S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------L--------------L-N--------NV------------------D--Y------I------------------V-------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------S-------------------------S-------------------S------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----------------------------------Y--------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
           Transcript 1 (1) 1.2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1. Transcript 1 (1)
           Transcript 1 (2) --Exon 1.8  PDB: E:5-95 UniProt: 34-124                                                      ----------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------------------------------------------------------------------------------Exon 1.9  PDB: E:95-189 UniProt: 124-218                                                       - Transcript 1 (3)
                 2q6w E   3 TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA 190
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Chain F from PDB  Type:PROTEIN  Length:12
 aligned with ITB3_HUMAN | P05106 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:12
                                    59  
           ITB3_HUMAN    50 AWCSDEALPLGS  61
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
           Pfam domains (1) Integrin_bet Pfam domains (1)
           Pfam domains (2) Integrin_bet Pfam domains (2)
         Sec.struct. author ............ Sec.struct. author
                 SAPs(SNPs) ---------P-- SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 2q6w F  24 AWRSDEALPLGS  35
                                    33

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 8)

Pfam Domains (4, 10)

Gene Ontology (107, 144)

Asymmetric Unit(hide GO term definitions)

Chain A,D (DRA_HUMAN | P01903)

molecular function
	GO:0023026	MHC class II protein complex binding	Interacting selectively and non-covalently with the class II major histocompatibility complex.
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0050890	cognition	The operation of the mind by which an organism becomes aware of objects of thought or perception; it includes the mental activities associated with thinking, learning, and memory.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0002503	peptide antigen assembly with MHC class II protein complex	The binding of a peptide to the antigen binding groove of an MHC class II protein complex.
	GO:0002506	polysaccharide assembly with MHC class II protein complex	The binding of a polysaccharide to the antigen binding groove of an MHC class II protein complex.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain B,E (DRB3_HUMAN | P79483)

molecular function
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain C,F (ITB3_HUMAN | P05106)

molecular function
	GO:0019960	C-X3-C chemokine binding	Interacting selectively and non-covalently with a C-X3-C chemokine; C-X3-C chemokines have three amino acids between the first two cysteines of the characteristic four-cysteine motif.
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0015026	coreceptor activity	Combining with an extracellular or intracellular messenger, and in cooperation with a nearby primary receptor, initiating a change in cell activity.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0017134	fibroblast growth factor binding	Interacting selectively and non-covalently with a fibroblast growth factor.
	GO:0001968	fibronectin binding	Interacting selectively and non-covalently with a fibronectin, a group of related adhesive glycoproteins of high molecular weight found on the surface of animal cells, connective tissue matrices, and in extracellular fluids.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0031994	insulin-like growth factor I binding	Interacting selectively and non-covalently with insulin-like growth factor I.
	GO:0038132	neuregulin binding	Interacting selectively and non-covalently with a neuregulin, a member of the EGF family of growth factors.
	GO:0005161	platelet-derived growth factor receptor binding	Interacting selectively and non-covalently with the platelet-derived growth factor receptor.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003756	protein disulfide isomerase activity	Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0043184	vascular endothelial growth factor receptor 2 binding	Interacting selectively and non-covalently with vascular endothelial growth factor receptor 2.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0032147	activation of protein kinase activity	Any process that initiates the activity of an inactive protein kinase.
	GO:0060055	angiogenesis involved in wound healing	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels and contribute to the series of events that restore integrity to a damaged tissue, following an injury.
	GO:0038027	apolipoprotein A-I-mediated signaling pathway	A series of molecular signals initiated by the binding of apolipoprotein A-I to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0016049	cell growth	The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0031589	cell-substrate adhesion	The attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0007044	cell-substrate junction assembly	The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0034113	heterotypic cell-cell adhesion	The attachment of a cell to a cell of a different type via adhesion molecules.
	GO:0007229	integrin-mediated signaling pathway	A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0048333	mesodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a mesoderm cell.
	GO:0050919	negative chemotaxis	The directed movement of a motile cell or organism towards a lower concentration of a chemical.
	GO:0010888	negative regulation of lipid storage	Any process that decreases the rate, frequency or extent of lipid storage. Lipid storage is the accumulation and maintenance in cells or tissues of lipids, compounds soluble in organic solvents but insoluble or sparingly soluble in aqueous solvents. Lipid reserves can be accumulated during early developmental stages for mobilization and utilization at later stages of development.
	GO:0032369	negative regulation of lipid transport	Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0050748	negative regulation of lipoprotein metabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving lipoproteins, any conjugated, water-soluble protein in which the nonprotein group consists of a lipid or lipids.
	GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of low-density lipoprotein particle receptors.
	GO:0010745	negative regulation of macrophage derived foam cell differentiation	Any process that decreases the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0010595	positive regulation of endothelial cell migration	Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0001938	positive regulation of endothelial cell proliferation	Any process that activates or increases the rate or extent of endothelial cell proliferation.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of vascular endothelial growth factor receptor signaling pathway activity.
	GO:0045124	regulation of bone resorption	Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:0014909	smooth muscle cell migration	The orderly movement of a smooth muscle cell from one site to another, often during the development of a multicellular organism.
	GO:0034446	substrate adhesion-dependent cell spreading	The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
	GO:0035295	tube development	The process whose specific outcome is the progression of a tube over time, from its initial formation to a mature structure. Epithelial and endothelial tubes transport gases, liquids and cells from one site to another and form the basic structure of many organs and tissues including lung and trachea, kidney, the mammary gland, the vascular system and the gastrointestinal and urinary-genital tracts.
	GO:0048010	vascular endothelial growth factor receptor signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
	GO:0071062	alphav-beta3 integrin-vitronectin complex	A protein complex that consists of an alphav-beta3 integrin complex bound to vitronectin.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031527	filopodium membrane	The portion of the plasma membrane surrounding a filopodium.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0034683	integrin alphav-beta3 complex	An integrin complex that comprises one alphav subunit and one beta3 subunit.
	GO:0008305	integrin complex	A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
	GO:0031258	lamellipodium membrane	The portion of the plasma membrane surrounding a lamellipodium.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031528	microvillus membrane	The portion of the plasma membrane surrounding a microvillus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031092	platelet alpha granule membrane	The lipid bilayer surrounding the platelet alpha granule.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (43, 86)

PROSITE Motifs (1, 4)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 8)

Pfam Domains (4, 10)

Gene Ontology (107, 144)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File