1SJH - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   HLA-DR1 COMPLEXED WITH A 13 RESIDUE HIV CAPSID PEPTIDE

Authors :   Z. Zavala-Ruiz, I. Strug, B. D. Walker, P. J. Norris, L. J. Stern

Date :   03 Mar 04 (Deposition) - 17 Aug 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.25

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (3x)

Keywords :   Mhc Class Ii, Major Histocompatibility Protein Complex, Hla- Dr1, Hiv-1, Capsid, Superantigen, Antigen, Peptide, Gag, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Z. Zavala-Ruiz, I. Strug, B. D. Walker, P. J. Norris, L. J. Stern
A Hairpin Turn In A Class Ii Mhc-Bound Peptide Orients Residues Outside The Binding Groove For T Cell Recognition.
Proc. Natl. Acad. Sci. Usa V. 101 13279 2004
PubMed-ID: 15331779 | Reference-DOI: 10.1073/PNAS.0403371101
(for further references see the PDB file header)

Molecule 1 - HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PLM1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	T7 POLYMERASE/LAC
	Fragment	:	EXTRACELLULAR DOMAIN OF HLA-DRA*0101
	Gene	:	HLA-DRA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MHC CLASS II ANTIGEN DRA

Molecule 2 - HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DRB1-1 BETA CHAIN
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PLM1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	T7 POLYMERASE/LAC
	Fragment	:	EXTRACELLULAR DOMAIN OF HLA-DRB*0101
	Gene	:	HLA-DRB1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MHC CLASS I ANTIGEN DRB1*1, DR-1, DR1

Molecule 3 - GAG POLYPROTEIN
	Chains	:	C
	Engineered	:	YES
	Fragment	:	13 RESIDUE PEPTIDE FROM HIV-1 GAG CAPSID PROTEIN
	Other Details	:	SYNTHESIZED PEPTIDE WITH SEQUENCE FROM HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (HIV-1) GAG CAPSID PROTEIN [166-178]
	Synthetic	:	YES

Molecule 4 - ENTEROTOXIN TYPE C-3
	Chains	:	D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	HB2151
	Expression System Taxid	:	562
	Expression System Vector Type	:	LAC
	Fragment	:	SEC3 VARIANT 3B2
	Gene	:	ENTC3, SAV2009, SA1817
	Mutation	:	YES
	Organism Scientific	:	STAPHYLOCOCCUS AUREUS
	Organism Taxid	:	1280
	Synonym	:	SEC3

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (3x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1SJH)

(no "Site" information available for 1SJH)

Asymmetric Unit

No.	Residues
1	A:107	-	A:163
2	B:15	-	B:79
3	B:117	-	B:173
4	D:93	-	D:110

Asymmetric Unit

No.	Residues
1	Asn A:15	-	Pro A:16
2	Thr A:113	-	Pro A:114
3	Tyr B:123	-	Pro B:124

Asymmetric Unit (25, 25)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_033379	R	33	K	2B11_HUMAN	Polymorphism	34716432	B	R	4	K
02	UniProt	VAR_033380	R	33	Q	2B11_HUMAN	Polymorphism	34716432	B	R	4	Q
03	UniProt	VAR_016740	Q	39	E	2B11_HUMAN	Polymorphism	---	B	Q	10	E
04	UniProt	VAR_033381	S	66	Y	2B11_HUMAN	Polymorphism	16822820	B	S	37	Y
05	UniProt	VAR_016741	G	74	R	2B11_HUMAN	Polymorphism	---	B	G	45	R
06	UniProt	VAR_033382	Y	76	F	2B11_HUMAN	Polymorphism	1060346	B	Y	47	F
07	UniProt	VAR_033383	Y	89	S	2B11_HUMAN	Polymorphism	36074728	B	Y	60	S
08	UniProt	VAR_016710	L	96	I	2B11_HUMAN	Polymorphism	---	B	L	67	I
09	UniProt	VAR_016711	Q	99	D	2B11_HUMAN	Polymorphism	---	B	Q	70	D
10	UniProt	VAR_033384	Q	99	E	2B11_HUMAN	Polymorphism	17881965	B	Q	70	E
11	UniProt	VAR_033385	Q	99	H	2B11_HUMAN	Polymorphism	17879599	B	Q	70	H
12	UniProt	VAR_016742	R	100	A	2B11_HUMAN	Polymorphism	---	B	R	71	A
13	UniProt	VAR_016712	R	100	E	2B11_HUMAN	Polymorphism	---	B	R	71	E
14	UniProt	VAR_033386	A	102	G	2B11_HUMAN	Polymorphism	17878857	B	A	73	G
15	UniProt	VAR_033387	A	103	E	2B11_HUMAN	Polymorphism	16822805	B	A	74	E
16	UniProt	VAR_016713	T	106	N	2B11_HUMAN	Polymorphism	16822752	B	T	77	N
17	UniProt	VAR_033388	Y	107	H	2B11_HUMAN	Polymorphism	16822512	B	Y	78	H
18	UniProt	VAR_016714	V	114	A	2B11_HUMAN	Polymorphism	17424145	B	V	85	A
19	UniProt	VAR_016715	G	115	V	2B11_HUMAN	Polymorphism	2230810	B	G	86	V
20	UniProt	VAR_033389	G	164	D	2B11_HUMAN	Polymorphism	1059633	B	G	135	D
21	UniProt	VAR_033390	A	169	T	2B11_HUMAN	Polymorphism	2308768	B	A	140	T
22	UniProt	VAR_033391	V	171	M	2B11_HUMAN	Polymorphism	701829	B	V	142	M
23	UniProt	VAR_033392	Q	178	H	2B11_HUMAN	Polymorphism	701830	B	Q	149	H
24	UniProt	VAR_033393	R	195	Q	2B11_HUMAN	Polymorphism	3205588	B	R	166	Q
25	UniProt	VAR_033394	T	210	I	2B11_HUMAN	Polymorphism	17423930	B	T	181	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (25, 75)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_033379	R	33	K	2B11_HUMAN	Polymorphism	34716432	B	R	4	K
02	UniProt	VAR_033380	R	33	Q	2B11_HUMAN	Polymorphism	34716432	B	R	4	Q
03	UniProt	VAR_016740	Q	39	E	2B11_HUMAN	Polymorphism	---	B	Q	10	E
04	UniProt	VAR_033381	S	66	Y	2B11_HUMAN	Polymorphism	16822820	B	S	37	Y
05	UniProt	VAR_016741	G	74	R	2B11_HUMAN	Polymorphism	---	B	G	45	R
06	UniProt	VAR_033382	Y	76	F	2B11_HUMAN	Polymorphism	1060346	B	Y	47	F
07	UniProt	VAR_033383	Y	89	S	2B11_HUMAN	Polymorphism	36074728	B	Y	60	S
08	UniProt	VAR_016710	L	96	I	2B11_HUMAN	Polymorphism	---	B	L	67	I
09	UniProt	VAR_016711	Q	99	D	2B11_HUMAN	Polymorphism	---	B	Q	70	D
10	UniProt	VAR_033384	Q	99	E	2B11_HUMAN	Polymorphism	17881965	B	Q	70	E
11	UniProt	VAR_033385	Q	99	H	2B11_HUMAN	Polymorphism	17879599	B	Q	70	H
12	UniProt	VAR_016742	R	100	A	2B11_HUMAN	Polymorphism	---	B	R	71	A
13	UniProt	VAR_016712	R	100	E	2B11_HUMAN	Polymorphism	---	B	R	71	E
14	UniProt	VAR_033386	A	102	G	2B11_HUMAN	Polymorphism	17878857	B	A	73	G
15	UniProt	VAR_033387	A	103	E	2B11_HUMAN	Polymorphism	16822805	B	A	74	E
16	UniProt	VAR_016713	T	106	N	2B11_HUMAN	Polymorphism	16822752	B	T	77	N
17	UniProt	VAR_033388	Y	107	H	2B11_HUMAN	Polymorphism	16822512	B	Y	78	H
18	UniProt	VAR_016714	V	114	A	2B11_HUMAN	Polymorphism	17424145	B	V	85	A
19	UniProt	VAR_016715	G	115	V	2B11_HUMAN	Polymorphism	2230810	B	G	86	V
20	UniProt	VAR_033389	G	164	D	2B11_HUMAN	Polymorphism	1059633	B	G	135	D
21	UniProt	VAR_033390	A	169	T	2B11_HUMAN	Polymorphism	2308768	B	A	140	T
22	UniProt	VAR_033391	V	171	M	2B11_HUMAN	Polymorphism	701829	B	V	142	M
23	UniProt	VAR_033392	Q	178	H	2B11_HUMAN	Polymorphism	701830	B	Q	149	H
24	UniProt	VAR_033393	R	195	Q	2B11_HUMAN	Polymorphism	3205588	B	R	166	Q
25	UniProt	VAR_033394	T	210	I	2B11_HUMAN	Polymorphism	17423930	B	T	181	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	STAPH_STREP_TOXIN_1	PS00277	Staphylococcal enterotoxin/Streptococcal pyrogenic exotoxin signature 1.	ENTC3_STAAU	139-148	1	D:112-121
2	STAPH_STREP_TOXIN_2	PS00278	Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.	ENTC3_STAAU	178-201	1	D:151-174
3	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	DRA_HUMAN	186-192	1	A:161-167
3	IG_MHC	PS00290		2B11_HUMAN	200-206	1	B:171-177

Biological Unit 1 (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	STAPH_STREP_TOXIN_1	PS00277	Staphylococcal enterotoxin/Streptococcal pyrogenic exotoxin signature 1.	ENTC3_STAAU	139-148	3	D:112-121
2	STAPH_STREP_TOXIN_2	PS00278	Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.	ENTC3_STAAU	178-201	3	D:151-174
3	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	DRA_HUMAN	186-192	3	A:161-167
3	IG_MHC	PS00290		2B11_HUMAN	200-206	3	B:171-177

Asymmetric Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3	ENST00000360004	3	ENSE00001930619	chr6:32557625-32557420	206	2B11_HUMAN	1-34	34	1	B:1-5	5
1.4	ENST00000360004	4	ENSE00001731226	chr6:32552155-32551886	270	2B11_HUMAN	34-124	91	1	B:5-95	91
1.5b	ENST00000360004	5b	ENSE00001801024	chr6:32549615-32549334	282	2B11_HUMAN	124-218	95	1	B:95-189	95
1.6	ENST00000360004	6	ENSE00001717727	chr6:32548633-32548523	111	2B11_HUMAN	218-255	38	1	B:189-190	2
1.7	ENST00000360004	7	ENSE00001773376	chr6:32548047-32548024	24	2B11_HUMAN	255-263	9	0	-	-
1.8	ENST00000360004	8	ENSE00001954617	chr6:32546881-32546546	336	2B11_HUMAN	263-266	4	0	-	-

2.6a	ENST00000383259	6a	ENSE00001839042	HSCHR6_MHC_QBL:32365090-32365280	191	DRA_HUMAN	1-28	28	0	-	-
2.7b	ENST00000383259	7b	ENSE00001719010	HSCHR6_MHC_QBL:32367694-32367939	246	DRA_HUMAN	28-110	83	1	A:4-85	82
2.8c	ENST00000383259	8c	ENSE00001737588	HSCHR6_MHC_QBL:32368431-32368712	282	DRA_HUMAN	110-204	95	1	A:85-179	95
2.9a	ENST00000383259	9a	ENSE00001770912	HSCHR6_MHC_QBL:32369002-32369167	166	DRA_HUMAN	204-254	51	1	A:179-182	4
2.10b	ENST00000383259	10b	ENSE00001925700	HSCHR6_MHC_QBL:32369906-32370300	395	DRA_HUMAN	-	0	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:179
 aligned with DRA_HUMAN | P01903 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:179
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198         
            DRA_HUMAN    29 EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 207
               SCOP domains d1sjha2 A:4-81 Class II MHC alpha chain, N-terminal domain                    d1sjha1 A:82-181 Class II MHC alpha chain, C-terminal domain                                        - SCOP domains
               CATH domains 1sjhA01 A:4-81                                                                1sjhA02 A:82-181 Immunoglobulins                                                                    - CATH domains
               Pfam domains MHC_II_alpha-1sjhA02 A:4-84                                                      --------C1-set-1sjhA01 A:93-175                                                            ------- Pfam domains
         Sec.struct. author .eeeeeeeeeee...eeeeeeee..eeeeeee....eeee...hhhhhh...hhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee...ee....ee...ee.....eeeeeeeee......eeeeeee.......eeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC --------------- PROSITE (2)
           Transcript 2 (1) Exon 2.7b  PDB: A:4-85 UniProt: 28-110 [INCOMPLETE]                               ---------------------------------------------------------------------------------------------2.9a Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------------------------------------------Exon 2.8c  PDB: A:85-179 UniProt: 110-204                                                      --- Transcript 2 (2)
                 1sjh A   4 EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDA 182
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173

Chain B from PDB  Type:PROTEIN  Length:190
 aligned with 2B11_HUMAN | P04229 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:190
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219
           2B11_HUMAN    30 GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA 219
               SCOP domains d1sjhb2 B:1-92 Class II MHC beta chain, N-terminal domain                                   d1sjhb1 B:93-190 Class II MHC beta chain, C-terminal domain                                        SCOP domains
               CATH domains 1sjhB01 B:1-92 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1         1sjhB02 B:93-190 Immunoglobulins                                                                   CATH domains
               Pfam domains ------------MHC_II_beta-1sjhB02 B:13-87                                                ---------------C1-set-1sjhB01 B:103-185                                                           ----- Pfam domains
         Sec.struct. author ......eeeeeeeeeeee....eeeeeeeee....eeeeee.....eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.........eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeee......eeeeeee.......eeeeee. Sec.struct. author
             SAPs(SNPs) (1) ---K-----E--------------------------Y-------R-F------------S------I--DA-GE--NH------AV------------------------------------------------D----T-M------H----------------Q--------------I--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---Q-----------------------------------------------------------------EE----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE (2)
           Transcript 1 (1) 1.3  -----------------------------------------------------------------------------------------Exon 1.5b  PDB: B:95-189 UniProt: 124-218                                                      - Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.4  PDB: B:5-95 UniProt: 34-124                                                      ---------------------------------------------------------------------------------------------1. Transcript 1 (2)
                 1sjh B   1 GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA 190
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain C from PDB  Type:PROTEIN  Length:13
 aligned with GAG_HV1Z2 | P12495 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:13
                                   176   
            GAG_HV1Z2   167 PEVIPMFSALSEG 179
               SCOP domains ------------- SCOP domains
               CATH domains ------------- CATH domains
               Pfam domains Gag_p24-1sjhC Pfam domains
         Sec.struct. author ............. Sec.struct. author
                 SAPs(SNPs) ------------- SAPs(SNPs)
                    PROSITE ------------- PROSITE
                 Transcript ------------- Transcript
                 1sjh C  34 PEVIPMFSALSEG  46
                                    43

Chain D from PDB  Type:PROTEIN  Length:230
 aligned with ENTC3_STAAU | P0A0L5 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:239
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         
          ENTC3_STAAU    28 ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG 266
               SCOP domains d1sjhd1 D:1-121 Staphylococcal enterotoxin C3, SEC3                                                                      d1sjhd2 D:122-239 Staphylococcal enterotoxin C3, SEC3                                                                  SCOP domains
               CATH domains 1sjhD02 D:1-31,D:120-237       1sjhD01 D:32-119  [code=2.40.50.110, no name defined]                                   1sjhD02 D:1-31,D:120-237  [code=3.10.20.120, no name defined]                                                         -- CATH domains
               Pfam domains ----------------------Stap_Strp_toxin-1sjhD02 D:23-118                                                                ----------Stap_Strp_tox_C-1sjhD01 D:129-235                                                                          ---- Pfam domains
         Sec.struct. author ......hhhhh.hhhhh...hhhhhhhhh...eeeeee.........eeee...........eeeee..hhhhhhhhh...eeeee..........---------..eeeee..eee...........eeeeeeeee..eeeeeeeeee...eeehhhhhhhhhhhhhhhhh..........eeeeeee.....eeeee.........hhhhhhhhhhhh.eee....eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------STAPH_STRE-----------------------------STAPH_STREP_TOXIN_2     ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sjh D   1 ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFS---------GGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG 239
                                    10        20        30        40        50        60        70        80        90     |   -     | 110       120       130       140       150       160       170       180       190       200       210       220       230         
                                                                                                                          96       106

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A (DRA_HUMAN | P01903)

molecular function
	GO:0023026	MHC class II protein complex binding	Interacting selectively and non-covalently with the class II major histocompatibility complex.
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0050890	cognition	The operation of the mind by which an organism becomes aware of objects of thought or perception; it includes the mental activities associated with thinking, learning, and memory.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0002503	peptide antigen assembly with MHC class II protein complex	The binding of a peptide to the antigen binding groove of an MHC class II protein complex.
	GO:0002506	polysaccharide assembly with MHC class II protein complex	The binding of a polysaccharide to the antigen binding groove of an MHC class II protein complex.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain B (2B11_HUMAN | P04229)

molecular function
	GO:0023026	MHC class II protein complex binding	Interacting selectively and non-covalently with the class II major histocompatibility complex.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0042088	T-helper 1 type immune response	An immune response which is associated with resistance to intracellular bacteria, fungi, and protozoa, and pathological conditions such as arthritis, and which is typically orchestrated by the production of particular cytokines by T-helper 1 cells, most notably interferon-gamma, IL-2, and lymphotoxin.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0016045	detection of bacterium	The series of events in which a stimulus from a bacterium is received and converted into a molecular signal.
	GO:0002455	humoral immune response mediated by circulating immunoglobulin	An immune response dependent upon secreted immunoglobulin. An example of this process is found in Mus musculus.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0002381	immunoglobulin production involved in immunoglobulin mediated immune response	The appearance of immunoglobulin due to biosynthesis or secretion following a cellular stimulus during an immune response, resulting in an increase in its intracellular or extracellular levels.
	GO:0002437	inflammatory response to antigenic stimulus	An inflammatory response to an antigenic stimulus, which can be include any number of T cell or B cell epitopes.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0042130	negative regulation of T cell proliferation	Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
	GO:0032689	negative regulation of interferon-gamma production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
	GO:0051262	protein tetramerization	The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
	GO:2001179	regulation of interleukin-10 secretion	Any process that modulates the frequency, rate or extent of interleukin-10 secretion.
	GO:0032673	regulation of interleukin-4 production	Any process that modulates the frequency, rate, or extent of interleukin-4 production.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain C (GAG_HV1Z2 | P12495)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0046755	viral budding	A viral process by which enveloped viruses acquire a host-derived membrane enriched in viral proteins to form their external envelope. The process starts when nucleocapsids, assembled or in the process of being built, induce formation of a membrane curvature in the host plasma or organelle membrane and wrap up in the forming bud. The process ends when the bud is eventually pinched off by membrane scission to release the enveloped particle into the lumenal or extracellular space.
	GO:0039702	viral budding via host ESCRT complex	Viral budding which uses a host ESCRT protein complex, or complexes, to mediate the budding process.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019076	viral release from host cell	The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
cellular component
	GO:0030430	host cell cytoplasm	The cytoplasm of a host cell.
	GO:0044174	host cell endosome	A membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to host cell lysosomes for degradation.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0042025	host cell nucleus	A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0072494	host multivesicular body	A late endosome in which regions of the limiting host cell endosomal membrane invaginate to form internal vesicles; host membrane proteins that enter the internal vesicles are sequestered from the host cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019013	viral nucleocapsid	The complete protein-nucleic acid complex that is the packaged form of the genome in a virus particle.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Chain D (ENTC3_STAAU | P0A0L5)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sjh)

	Sites
(no "Sites" information available for 1sjh)

	Cis Peptide Bonds
		Asn A:15 - Pro A:16	[ RasMol ]
		Thr A:113 - Pro A:114	[ RasMol ]
		Tyr B:123 - Pro B:124	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1sjh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	2B11_HUMAN \| P04229
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	DRA_HUMAN \| P01903
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ENTC3_STAAU \| P0A0L5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GAG_HV1Z2 \| P12495
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	2B11_HUMAN \| P04229
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	DRA_HUMAN \| P01903
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ENTC3_STAAU \| P0A0L5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GAG_HV1Z2 \| P12495
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1klu	HLA-DR1/TPI/SEC3-3B2, SIMILAR TO CURRENT ENTRY BUT A DIFFERENT PEPTIDE BOUND TO HLA-DR1
1pyw	HLA-DR1/FVKQNAAAL/SEC3-3B2 (A IS N-METHYL ALANINE), SIMILAR TO CURRENT ENTRY BUT A DIFFERENT PEPTIDE BOUND TO HLA-DR1
1sje	HLA-DR1 COMPLEXED WITH A 16 RESIDUE HIV CAPSID PEPTIDE BOUND IN A HAIRPIN CONFORMATION

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (25, 25)

PROSITE Motifs (3, 4)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (6, 6)

CATH Domains (4, 6)

Pfam Domains (6, 7)

Gene Ontology (71, 104)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File