3T3M - JenaLib

Asymmetric Unit (49, 98)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_014176	T	40	I	ITA2B_HUMAN	Polymorphism	5915	A/C	T	9	I
02	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	B/D	L	33	P
03	UniProt	VAR_069920	C	64	Y	ITB3_HUMAN	Disease (GT)	74554539	B/D	C	38	Y
04	UniProt	VAR_049633	L	66	R	ITB3_HUMAN	Polymorphism	36080296	B/D	L	40	R
05	UniProt	VAR_030445	L	86	P	ITA2B_HUMAN	Disease (GT)	---	A/C	L	55	P
06	UniProt	VAR_030473	R	119	W	ITB3_HUMAN	Disease (GT)	781062792	B/D	R	93	W
07	UniProt	VAR_030446	A	139	V	ITA2B_HUMAN	Disease (GT)	---	A/C	A	108	V
08	UniProt	VAR_030474	Y	141	C	ITB3_HUMAN	Disease (GT)	---	B/D	Y	115	C
09	UniProt	VAR_010649	L	143	W	ITB3_HUMAN	Disease (GT)	121918452	B/D	L	117	W
10	UniProt	VAR_069921	M	144	R	ITB3_HUMAN	Disease (GT)	77963874	B/D	M	118	R
11	UniProt	VAR_030475	D	145	N	ITB3_HUMAN	Disease (GT)	---	B/D	D	119	N
12	UniProt	VAR_003998	D	145	Y	ITB3_HUMAN	Disease (GT)	121918445	B/D	D	119	Y
13	UniProt	VAR_030476	M	150	V	ITB3_HUMAN	Disease (GT)	767548512	B/D	M	124	V
14	UniProt	VAR_030447	C	161	W	ITA2B_HUMAN	Disease (GT)	---	A/C	C	130	W
15	UniProt	VAR_030477	T	166	I	ITB3_HUMAN	Polymorphism	74708909	B/D	T	140	I
16	UniProt	VAR_030448	Y	174	H	ITA2B_HUMAN	Disease (GT)	---	A/C	Y	143	H
17	UniProt	VAR_003994	R	169	Q	ITB3_HUMAN	Polymorphism	5917	B/D	R	143	Q
18	UniProt	VAR_009885	P	176	A	ITA2B_HUMAN	Disease (GT)	---	A/C	P	145	A
19	UniProt	VAR_009886	P	176	L	ITA2B_HUMAN	Disease (GT)	---	A/C	P	145	L
20	UniProt	VAR_010651	S	188	L	ITB3_HUMAN	Disease (GT)	143146734	B/D	S	162	L
21	UniProt	VAR_030449	F	202	C	ITA2B_HUMAN	Disease (GT)	---	A/C	F	171	C
22	UniProt	VAR_030450	T	207	I	ITA2B_HUMAN	Disease (GT)	---	A/C	T	176	I
23	UniProt	VAR_030451	L	214	P	ITA2B_HUMAN	Disease (GT)	137852911	A/C	L	183	P
24	UniProt	VAR_030452	F	222	L	ITA2B_HUMAN	Disease (GT)	---	A/C	F	191	L
25	UniProt	VAR_030478	L	222	P	ITB3_HUMAN	Disease (GT)	79208797	B/D	L	196	P
26	UniProt	VAR_003999	R	240	Q	ITB3_HUMAN	Disease (GT)	121918444	B/D	R	214	Q
27	UniProt	VAR_004000	R	240	W	ITB3_HUMAN	Disease (GT)	121918446	B/D	R	214	W
28	UniProt	VAR_030479	R	242	Q	ITB3_HUMAN	Disease (GT)	377162158	B/D	R	216	Q
29	UniProt	VAR_030480	D	243	V	ITB3_HUMAN	Disease (GT)	---	B/D	D	217	V
30	UniProt	VAR_069922	G	247	D	ITB3_HUMAN	Disease (GT)	79560904	B/D	G	221	D
31	UniProt	VAR_030453	G	267	E	ITA2B_HUMAN	Disease (GT)	---	A/C	G	236	E
32	UniProt	VAR_003979	G	273	D	ITA2B_HUMAN	Disease (GT)	137852907	A/C	G	242	D
33	UniProt	VAR_069923	K	279	M	ITB3_HUMAN	Disease (GT)	79775494	B/D	K	253	M
34	UniProt	VAR_030481	L	288	P	ITB3_HUMAN	Disease (GT)	---	B/D	L	262	P
35	UniProt	VAR_004001	H	306	P	ITB3_HUMAN	Disease (GT)	13306476	B/D	H	280	P
36	UniProt	VAR_054820	G	313	A	ITA2B_HUMAN	Polymorphism	1126554	A/C	G	282	A
37	UniProt	VAR_009887	F	320	S	ITA2B_HUMAN	Disease (GT)	---	A/C	F	289	S
38	UniProt	VAR_030482	M	321	L	ITB3_HUMAN	Disease (GT)	---	B/D	M	295	L
39	UniProt	VAR_030454	V	329	F	ITA2B_HUMAN	Disease (GT)	---	A/C	V	298	F
40	UniProt	VAR_030483	I	330	N	ITB3_HUMAN	Disease (GT)	---	B/D	I	304	N
41	UniProt	VAR_009888	E	355	K	ITA2B_HUMAN	Disease (GT)	137852910	A/C	E	324	K
42	UniProt	VAR_003980	R	358	H	ITA2B_HUMAN	Disease (GT)	137852908	A/C	R	327	H
43	UniProt	VAR_030455	G	380	D	ITA2B_HUMAN	Disease (GT)	766006685	A/C	G	349	D
44	UniProt	VAR_030456	I	405	T	ITA2B_HUMAN	Disease (GT)	75622274	A/C	I	374	T
45	UniProt	VAR_004002	C	400	Y	ITB3_HUMAN	Disease (GT)	121918449	B/D	C	374	Y
46	UniProt	VAR_030457	G	412	R	ITA2B_HUMAN	Disease (GT)	780786843	A/C	G	381	R
47	UniProt	VAR_003995	P	433	A	ITB3_HUMAN	Polymorphism	121918448	B/D	P	407	A
48	UniProt	VAR_003981	G	449	D	ITA2B_HUMAN	Disease (GT)	---	A/C	G	418	D
49	UniProt	VAR_014178	V	453	I	ITB3_HUMAN	Polymorphism	5921	B/D	V	427	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (49, 49)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_014176	T	40	I	ITA2B_HUMAN	Polymorphism	5915	A	T	9	I
02	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	B	L	33	P
03	UniProt	VAR_069920	C	64	Y	ITB3_HUMAN	Disease (GT)	74554539	B	C	38	Y
04	UniProt	VAR_049633	L	66	R	ITB3_HUMAN	Polymorphism	36080296	B	L	40	R
05	UniProt	VAR_030445	L	86	P	ITA2B_HUMAN	Disease (GT)	---	A	L	55	P
06	UniProt	VAR_030473	R	119	W	ITB3_HUMAN	Disease (GT)	781062792	B	R	93	W
07	UniProt	VAR_030446	A	139	V	ITA2B_HUMAN	Disease (GT)	---	A	A	108	V
08	UniProt	VAR_030474	Y	141	C	ITB3_HUMAN	Disease (GT)	---	B	Y	115	C
09	UniProt	VAR_010649	L	143	W	ITB3_HUMAN	Disease (GT)	121918452	B	L	117	W
10	UniProt	VAR_069921	M	144	R	ITB3_HUMAN	Disease (GT)	77963874	B	M	118	R
11	UniProt	VAR_030475	D	145	N	ITB3_HUMAN	Disease (GT)	---	B	D	119	N
12	UniProt	VAR_003998	D	145	Y	ITB3_HUMAN	Disease (GT)	121918445	B	D	119	Y
13	UniProt	VAR_030476	M	150	V	ITB3_HUMAN	Disease (GT)	767548512	B	M	124	V
14	UniProt	VAR_030447	C	161	W	ITA2B_HUMAN	Disease (GT)	---	A	C	130	W
15	UniProt	VAR_030477	T	166	I	ITB3_HUMAN	Polymorphism	74708909	B	T	140	I
16	UniProt	VAR_030448	Y	174	H	ITA2B_HUMAN	Disease (GT)	---	A	Y	143	H
17	UniProt	VAR_003994	R	169	Q	ITB3_HUMAN	Polymorphism	5917	B	R	143	Q
18	UniProt	VAR_009885	P	176	A	ITA2B_HUMAN	Disease (GT)	---	A	P	145	A
19	UniProt	VAR_009886	P	176	L	ITA2B_HUMAN	Disease (GT)	---	A	P	145	L
20	UniProt	VAR_010651	S	188	L	ITB3_HUMAN	Disease (GT)	143146734	B	S	162	L
21	UniProt	VAR_030449	F	202	C	ITA2B_HUMAN	Disease (GT)	---	A	F	171	C
22	UniProt	VAR_030450	T	207	I	ITA2B_HUMAN	Disease (GT)	---	A	T	176	I
23	UniProt	VAR_030451	L	214	P	ITA2B_HUMAN	Disease (GT)	137852911	A	L	183	P
24	UniProt	VAR_030452	F	222	L	ITA2B_HUMAN	Disease (GT)	---	A	F	191	L
25	UniProt	VAR_030478	L	222	P	ITB3_HUMAN	Disease (GT)	79208797	B	L	196	P
26	UniProt	VAR_003999	R	240	Q	ITB3_HUMAN	Disease (GT)	121918444	B	R	214	Q
27	UniProt	VAR_004000	R	240	W	ITB3_HUMAN	Disease (GT)	121918446	B	R	214	W
28	UniProt	VAR_030479	R	242	Q	ITB3_HUMAN	Disease (GT)	377162158	B	R	216	Q
29	UniProt	VAR_030480	D	243	V	ITB3_HUMAN	Disease (GT)	---	B	D	217	V
30	UniProt	VAR_069922	G	247	D	ITB3_HUMAN	Disease (GT)	79560904	B	G	221	D
31	UniProt	VAR_030453	G	267	E	ITA2B_HUMAN	Disease (GT)	---	A	G	236	E
32	UniProt	VAR_003979	G	273	D	ITA2B_HUMAN	Disease (GT)	137852907	A	G	242	D
33	UniProt	VAR_069923	K	279	M	ITB3_HUMAN	Disease (GT)	79775494	B	K	253	M
34	UniProt	VAR_030481	L	288	P	ITB3_HUMAN	Disease (GT)	---	B	L	262	P
35	UniProt	VAR_004001	H	306	P	ITB3_HUMAN	Disease (GT)	13306476	B	H	280	P
36	UniProt	VAR_054820	G	313	A	ITA2B_HUMAN	Polymorphism	1126554	A	G	282	A
37	UniProt	VAR_009887	F	320	S	ITA2B_HUMAN	Disease (GT)	---	A	F	289	S
38	UniProt	VAR_030482	M	321	L	ITB3_HUMAN	Disease (GT)	---	B	M	295	L
39	UniProt	VAR_030454	V	329	F	ITA2B_HUMAN	Disease (GT)	---	A	V	298	F
40	UniProt	VAR_030483	I	330	N	ITB3_HUMAN	Disease (GT)	---	B	I	304	N
41	UniProt	VAR_009888	E	355	K	ITA2B_HUMAN	Disease (GT)	137852910	A	E	324	K
42	UniProt	VAR_003980	R	358	H	ITA2B_HUMAN	Disease (GT)	137852908	A	R	327	H
43	UniProt	VAR_030455	G	380	D	ITA2B_HUMAN	Disease (GT)	766006685	A	G	349	D
44	UniProt	VAR_030456	I	405	T	ITA2B_HUMAN	Disease (GT)	75622274	A	I	374	T
45	UniProt	VAR_004002	C	400	Y	ITB3_HUMAN	Disease (GT)	121918449	B	C	374	Y
46	UniProt	VAR_030457	G	412	R	ITA2B_HUMAN	Disease (GT)	780786843	A	G	381	R
47	UniProt	VAR_003995	P	433	A	ITB3_HUMAN	Polymorphism	121918448	B	P	407	A
48	UniProt	VAR_003981	G	449	D	ITA2B_HUMAN	Disease (GT)	---	A	G	418	D
49	UniProt	VAR_014178	V	453	I	ITB3_HUMAN	Polymorphism	5921	B	V	427	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (49, 49)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_014176	T	40	I	ITA2B_HUMAN	Polymorphism	5915	C	T	9	I
02	UniProt	VAR_003993	L	59	P	ITB3_HUMAN	Polymorphism	5918	D	L	33	P
03	UniProt	VAR_069920	C	64	Y	ITB3_HUMAN	Disease (GT)	74554539	D	C	38	Y
04	UniProt	VAR_049633	L	66	R	ITB3_HUMAN	Polymorphism	36080296	D	L	40	R
05	UniProt	VAR_030445	L	86	P	ITA2B_HUMAN	Disease (GT)	---	C	L	55	P
06	UniProt	VAR_030473	R	119	W	ITB3_HUMAN	Disease (GT)	781062792	D	R	93	W
07	UniProt	VAR_030446	A	139	V	ITA2B_HUMAN	Disease (GT)	---	C	A	108	V
08	UniProt	VAR_030474	Y	141	C	ITB3_HUMAN	Disease (GT)	---	D	Y	115	C
09	UniProt	VAR_010649	L	143	W	ITB3_HUMAN	Disease (GT)	121918452	D	L	117	W
10	UniProt	VAR_069921	M	144	R	ITB3_HUMAN	Disease (GT)	77963874	D	M	118	R
11	UniProt	VAR_030475	D	145	N	ITB3_HUMAN	Disease (GT)	---	D	D	119	N
12	UniProt	VAR_003998	D	145	Y	ITB3_HUMAN	Disease (GT)	121918445	D	D	119	Y
13	UniProt	VAR_030476	M	150	V	ITB3_HUMAN	Disease (GT)	767548512	D	M	124	V
14	UniProt	VAR_030447	C	161	W	ITA2B_HUMAN	Disease (GT)	---	C	C	130	W
15	UniProt	VAR_030477	T	166	I	ITB3_HUMAN	Polymorphism	74708909	D	T	140	I
16	UniProt	VAR_030448	Y	174	H	ITA2B_HUMAN	Disease (GT)	---	C	Y	143	H
17	UniProt	VAR_003994	R	169	Q	ITB3_HUMAN	Polymorphism	5917	D	R	143	Q
18	UniProt	VAR_009885	P	176	A	ITA2B_HUMAN	Disease (GT)	---	C	P	145	A
19	UniProt	VAR_009886	P	176	L	ITA2B_HUMAN	Disease (GT)	---	C	P	145	L
20	UniProt	VAR_010651	S	188	L	ITB3_HUMAN	Disease (GT)	143146734	D	S	162	L
21	UniProt	VAR_030449	F	202	C	ITA2B_HUMAN	Disease (GT)	---	C	F	171	C
22	UniProt	VAR_030450	T	207	I	ITA2B_HUMAN	Disease (GT)	---	C	T	176	I
23	UniProt	VAR_030451	L	214	P	ITA2B_HUMAN	Disease (GT)	137852911	C	L	183	P
24	UniProt	VAR_030452	F	222	L	ITA2B_HUMAN	Disease (GT)	---	C	F	191	L
25	UniProt	VAR_030478	L	222	P	ITB3_HUMAN	Disease (GT)	79208797	D	L	196	P
26	UniProt	VAR_003999	R	240	Q	ITB3_HUMAN	Disease (GT)	121918444	D	R	214	Q
27	UniProt	VAR_004000	R	240	W	ITB3_HUMAN	Disease (GT)	121918446	D	R	214	W
28	UniProt	VAR_030479	R	242	Q	ITB3_HUMAN	Disease (GT)	377162158	D	R	216	Q
29	UniProt	VAR_030480	D	243	V	ITB3_HUMAN	Disease (GT)	---	D	D	217	V
30	UniProt	VAR_069922	G	247	D	ITB3_HUMAN	Disease (GT)	79560904	D	G	221	D
31	UniProt	VAR_030453	G	267	E	ITA2B_HUMAN	Disease (GT)	---	C	G	236	E
32	UniProt	VAR_003979	G	273	D	ITA2B_HUMAN	Disease (GT)	137852907	C	G	242	D
33	UniProt	VAR_069923	K	279	M	ITB3_HUMAN	Disease (GT)	79775494	D	K	253	M
34	UniProt	VAR_030481	L	288	P	ITB3_HUMAN	Disease (GT)	---	D	L	262	P
35	UniProt	VAR_004001	H	306	P	ITB3_HUMAN	Disease (GT)	13306476	D	H	280	P
36	UniProt	VAR_054820	G	313	A	ITA2B_HUMAN	Polymorphism	1126554	C	G	282	A
37	UniProt	VAR_009887	F	320	S	ITA2B_HUMAN	Disease (GT)	---	C	F	289	S
38	UniProt	VAR_030482	M	321	L	ITB3_HUMAN	Disease (GT)	---	D	M	295	L
39	UniProt	VAR_030454	V	329	F	ITA2B_HUMAN	Disease (GT)	---	C	V	298	F
40	UniProt	VAR_030483	I	330	N	ITB3_HUMAN	Disease (GT)	---	D	I	304	N
41	UniProt	VAR_009888	E	355	K	ITA2B_HUMAN	Disease (GT)	137852910	C	E	324	K
42	UniProt	VAR_003980	R	358	H	ITA2B_HUMAN	Disease (GT)	137852908	C	R	327	H
43	UniProt	VAR_030455	G	380	D	ITA2B_HUMAN	Disease (GT)	766006685	C	G	349	D
44	UniProt	VAR_030456	I	405	T	ITA2B_HUMAN	Disease (GT)	75622274	C	I	374	T
45	UniProt	VAR_004002	C	400	Y	ITB3_HUMAN	Disease (GT)	121918449	D	C	374	Y
46	UniProt	VAR_030457	G	412	R	ITA2B_HUMAN	Disease (GT)	780786843	C	G	381	R
47	UniProt	VAR_003995	P	433	A	ITB3_HUMAN	Polymorphism	121918448	D	P	407	A
48	UniProt	VAR_003981	G	449	D	ITA2B_HUMAN	Disease (GT)	---	C	G	418	D
49	UniProt	VAR_014178	V	453	I	ITB3_HUMAN	Polymorphism	5921	D	V	427	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (3, 16)

Exons (15, 30)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:454
 aligned with ITA2B_HUMAN | P08514 from UniProtKB/Swiss-Prot  Length:1039

    Alignment length:454
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481    
          ITA2B_HUMAN    32 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV 485
               SCOP domains d3t3ma_ A: Integrin alpha N-terminal domain                                                                                                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..........eeeee.....eeeeeee............eeeeee.................eeeee..eeeeee.........eeee..eeeeee...eeeeee..ee.......eeeee......eeee.......hhhhhhhh..............eee....eeeeee.hhhhhh.eeeeeehhhhhhhh............ee.....hhhhh.......eeee.........eeeeee.hhhhhh.eeeee.....eeeeee...........eeee........eeeeee...eeee...eeee..eeeee.............eeee...........eeeee........eeeeee.........eeeee.ee..ee.....eeee...........eeeeee........eeeeeehhh.eeeee...... Sec.struct. author
             SAPs(SNPs) (1) --------I---------------------------------------------P----------------------------------------------------V---------------------W------------H-A-------------------------C----I------P-------L--------------------------------------------E-----D---------------------------------------A------S--------F-------------------------K--H---------------------D------------------------T------R------------------------------------D------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------L--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---FG_GAP  PDB: A:4-65 UniProt: 35-96                            -------------FG_GAP  PDB: A:79-142 UniProt: 110-173                          -------------FG_GAP  PDB: A:156-207 UniProt: 187-238             ------------FG_GAP  PDB: A:220-274 UniProt: 251-305                FG_GAP  PDB: A:275-340 UniProt: 306-371                           -FG_GAP  PDB: A:342-401 UniProt: 373-432                     --FG_GAP  PDB: A:404-454 UniProt: 435-496             PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-32           ----------------------------------------Exon 1.3  PDB: A:73-105          Exon 1.4  PDB: A:106-161 UniProt: 137-192               ----------------Exon 1.6        ------------------------------------------Exon 1.8         --------------Exon 1.10         Exon 1.11         ----------------------------------------------------------------------Exon 1.13  PDB: A:373-434 UniProt: 404-465                    --------------1.15   Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.2  PDB: A:32-73 UniProt: 63-104    ---------------------------------------------------------------------------------------Exon 1.5         ---------------Exon 1.7  PDB: A:193-236 UniProt: 224-267   ---------------Exon 1.9       -----------------------------------Exon 1.12  PDB: A:302-373 UniProt: 333-404                              ------------------------------------------------------------Exon 1.14       ----- Transcript 1 (2)
                 3t3m A   1 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV 454
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450

Chain B from PDB  Type:PROTEIN  Length:466
 aligned with ITB3_HUMAN | P05106 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:466
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486      
           ITB3_HUMAN    27 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW 492
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh..hhhhhhh.....eee...........eehhhhhhh...hhh.ee....eeeeee.................ee..eeeeee....eeeeeeeee......eeeeeeee.hhhhhhhhhhh.hhhhhhhhhhh.....eeeeeeee.............hhhhhh..............eeeeeeee..hhhhhhhhh............hhhhhhhhhhhhhhhhh.....eeeeeeee.......hhhhhhh..........................hhhhhhhhhhhh.eeeeeee...hhhhhhhhhh.....eeee......hhhhhhhhhhhhhh.eeeeeee......eeeeeeee...eeee...eee......eeeeeeeee........eeeeeeee......eeeeeee...hhhhhhh...........eeee..eeee.... Sec.struct. author
             SAPs(SNPs) (1) --------------------------------P----Y-R----------------------------------------------------W---------------------C-WRN----V---------------I--Q------------------L---------------------------------P-----------------Q-QV---D-------------------------------M--------P-----------------P--------------L--------N---------------------------------------------------------------------Y--------------------------------A-------------------I--------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------Y----------------------------------------------------------------------------------------------W------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_2   PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_1   PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3t3m B   1 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW 466
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460

Chain C from PDB  Type:PROTEIN  Length:453
 aligned with ITA2B_HUMAN | P08514 from UniProtKB/Swiss-Prot  Length:1039

    Alignment length:453
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481   
          ITA2B_HUMAN    32 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPV 484
               SCOP domains d3t3mc_ C: Integrin alpha N-terminal domain                                                                                                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee.........eeeeee.....eeeeeee............eeeeee..................eeee..eeeeee.........eeee..eeeeee...eeeeee..ee.......eeeee......eeee.......hhhhhhhh..............eee....eeeeee.hhhhhh.eeeeeehhhhhhhh............ee.....hhhhh.......eeee.........eeeeee.hhhhhh.eeeee.....eeeeee...........eeee........eeeeee...eeee...eeee..eeeee.............eeee...........eeeee........eeeeee.........eeeee.ee..ee.....eeee...........eeeeee........eeeeeehhh.eeeee..... Sec.struct. author
             SAPs(SNPs) (1) --------I---------------------------------------------P----------------------------------------------------V---------------------W------------H-A-------------------------C----I------P-------L--------------------------------------------E-----D---------------------------------------A------S--------F-------------------------K--H---------------------D------------------------T------R------------------------------------D----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------L-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---FG_GAP  PDB: C:4-65 UniProt: 35-96                            -------------FG_GAP  PDB: C:79-142 UniProt: 110-173                          -------------FG_GAP  PDB: C:156-207 UniProt: 187-238             ------------FG_GAP  PDB: C:220-274 UniProt: 251-305                FG_GAP  PDB: C:275-340 UniProt: 306-371                           -FG_GAP  PDB: C:342-401 UniProt: 373-432                     --FG_GAP  PDB: C:404-453 UniProt: 435-496            PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:1-32           ----------------------------------------Exon 1.3  PDB: C:73-105          Exon 1.4  PDB: C:106-161 UniProt: 137-192               ----------------Exon 1.6        ------------------------------------------Exon 1.8         --------------Exon 1.10         Exon 1.11         ----------------------------------------------------------------------Exon 1.13  PDB: C:373-434 UniProt: 404-465                    --------------1.15  Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.2  PDB: C:32-73 UniProt: 63-104    ---------------------------------------------------------------------------------------Exon 1.5         ---------------Exon 1.7  PDB: C:193-236 UniProt: 224-267   ---------------Exon 1.9       -----------------------------------Exon 1.12  PDB: C:302-373 UniProt: 333-404                              ------------------------------------------------------------Exon 1.14       ---- Transcript 1 (2)
                 3t3m C   1 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPV 453
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450

Chain D from PDB  Type:PROTEIN  Length:471
 aligned with ITB3_HUMAN | P05106 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:471
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496 
           ITB3_HUMAN    27 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC 497
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhh...eee...........eehhhhhhhh..hhh.ee....eeeeee..........hhhhh..ee..eeeeee....eeeeeeeee......eeeeeeee.hhhhhhhhhhh.hhhhhhhhhhh.....eeeeeeee............hhhhhhh..............eeeeeeee..hhhhhhhhhh...........hhhhhhhhhhhhhhhhh.....eeeeeeee.......hhhhhhh..........................hhhhhhhhhhhhh.eeeeeee..hhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh..eeeeee.....eeeeeeee.....eee...ee.......eeeeeeeeee.......eeeeeeee......eeeeeee...hhhhhhh...........eeee..eeee......... Sec.struct. author
             SAPs(SNPs) (1) --------------------------------P----Y-R----------------------------------------------------W---------------------C-WRN----V---------------I--Q------------------L---------------------------------P-----------------Q-QV---D-------------------------------M--------P-----------------P--------------L--------N---------------------------------------------------------------------Y--------------------------------A-------------------I-------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------Y----------------------------------------------------------------------------------------------W----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_2        PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_1        PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3t3m D   1 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC 471
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470

Chain E from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eee.....eeeeeeee..hhhhh.eeeeeee...eeeeeeee......eee.......eeeeee....eeeeee...hhhhheeeeeee.........ee...eeeee........eeee......eeeeeeeee.......eeee..............ee....eee..eeeee.........eeeee........eee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3t3m E   1 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR 219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   ||  145       155       165       175       185       195       205       215    
                                                                                                                                                               134|                                                                               
                                                                                                                                                                140

Chain F from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains d3t3mf1 F:1-107 automated matches                                                                          d3t3mf2 F:108-214 automated matches                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee.......eeeeee.....eeeeee...ee.......eeeeee..eeeeee...hhhhh.eeeeee......ee...eeeee.......ee.....hhhhhhh.eeeee..ee.......eeeeee..eee...eeeee...........eeeeeeeehhhhh...eeeeeee...........ee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3t3m F   1 DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain H from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee...eee.....eeeeeeee..hhhhh.eeeeeee...eeeeeeee......eee.hhhh..eeeeeehhh.eeeeee........eeeeeee.........ee...eeeee........eeeee.......eeeeeeeeeee.....eeee........eee...eee..eeeeeeeeeee.........eeeeee....eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3t3m H   1 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR 219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   ||  143       153       163       173       183       193       203       213      
                                                                                                                                                               134|                                                                                 
                                                                                                                                                                138

Chain L from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains d3t3ml1 L:1-107 automated matches                                                                          d3t3ml2 L:108-214 automated matches                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee.......eeeeee.....eeeeee...ee.......eeeeee..eeeeee...hhhhh.eeeeee......ee...eeeee.......eeeee..hhhhhh..eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhh...eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3t3m L   1 DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (81, 99)

Asymmetric Unit(hide GO term definitions)

Chain A,C (ITA2B_HUMAN | P08514)

molecular function
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0070051	fibrinogen binding	Interacting selectively and non-covalently with fibrinogen, a highly soluble hexameric glycoprotein complex that is found in blood plasma and is converted to fibrin by thrombin in the coagulation cascade.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0007229	integrin-mediated signaling pathway	A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0002687	positive regulation of leukocyte migration	Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0008305	integrin complex	A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031092	platelet alpha granule membrane	The lipid bilayer surrounding the platelet alpha granule.

Chain B,D (ITB3_HUMAN | P05106)

molecular function
	GO:0019960	C-X3-C chemokine binding	Interacting selectively and non-covalently with a C-X3-C chemokine; C-X3-C chemokines have three amino acids between the first two cysteines of the characteristic four-cysteine motif.
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0015026	coreceptor activity	Combining with an extracellular or intracellular messenger, and in cooperation with a nearby primary receptor, initiating a change in cell activity.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0017134	fibroblast growth factor binding	Interacting selectively and non-covalently with a fibroblast growth factor.
	GO:0001968	fibronectin binding	Interacting selectively and non-covalently with a fibronectin, a group of related adhesive glycoproteins of high molecular weight found on the surface of animal cells, connective tissue matrices, and in extracellular fluids.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0031994	insulin-like growth factor I binding	Interacting selectively and non-covalently with insulin-like growth factor I.
	GO:0038132	neuregulin binding	Interacting selectively and non-covalently with a neuregulin, a member of the EGF family of growth factors.
	GO:0005161	platelet-derived growth factor receptor binding	Interacting selectively and non-covalently with the platelet-derived growth factor receptor.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003756	protein disulfide isomerase activity	Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0043184	vascular endothelial growth factor receptor 2 binding	Interacting selectively and non-covalently with vascular endothelial growth factor receptor 2.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0032147	activation of protein kinase activity	Any process that initiates the activity of an inactive protein kinase.
	GO:0060055	angiogenesis involved in wound healing	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels and contribute to the series of events that restore integrity to a damaged tissue, following an injury.
	GO:0038027	apolipoprotein A-I-mediated signaling pathway	A series of molecular signals initiated by the binding of apolipoprotein A-I to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0016049	cell growth	The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0031589	cell-substrate adhesion	The attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0007044	cell-substrate junction assembly	The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0034113	heterotypic cell-cell adhesion	The attachment of a cell to a cell of a different type via adhesion molecules.
	GO:0007229	integrin-mediated signaling pathway	A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0048333	mesodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a mesoderm cell.
	GO:0050919	negative chemotaxis	The directed movement of a motile cell or organism towards a lower concentration of a chemical.
	GO:0010888	negative regulation of lipid storage	Any process that decreases the rate, frequency or extent of lipid storage. Lipid storage is the accumulation and maintenance in cells or tissues of lipids, compounds soluble in organic solvents but insoluble or sparingly soluble in aqueous solvents. Lipid reserves can be accumulated during early developmental stages for mobilization and utilization at later stages of development.
	GO:0032369	negative regulation of lipid transport	Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0050748	negative regulation of lipoprotein metabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving lipoproteins, any conjugated, water-soluble protein in which the nonprotein group consists of a lipid or lipids.
	GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of low-density lipoprotein particle receptors.
	GO:0010745	negative regulation of macrophage derived foam cell differentiation	Any process that decreases the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0010595	positive regulation of endothelial cell migration	Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0001938	positive regulation of endothelial cell proliferation	Any process that activates or increases the rate or extent of endothelial cell proliferation.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of vascular endothelial growth factor receptor signaling pathway activity.
	GO:0045124	regulation of bone resorption	Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:0014909	smooth muscle cell migration	The orderly movement of a smooth muscle cell from one site to another, often during the development of a multicellular organism.
	GO:0034446	substrate adhesion-dependent cell spreading	The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
	GO:0035295	tube development	The process whose specific outcome is the progression of a tube over time, from its initial formation to a mature structure. Epithelial and endothelial tubes transport gases, liquids and cells from one site to another and form the basic structure of many organs and tissues including lung and trachea, kidney, the mammary gland, the vascular system and the gastrointestinal and urinary-genital tracts.
	GO:0048010	vascular endothelial growth factor receptor signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
	GO:0071062	alphav-beta3 integrin-vitronectin complex	A protein complex that consists of an alphav-beta3 integrin complex bound to vitronectin.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031527	filopodium membrane	The portion of the plasma membrane surrounding a filopodium.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0034683	integrin alphav-beta3 complex	An integrin complex that comprises one alphav subunit and one beta3 subunit.
	GO:0008305	integrin complex	A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
	GO:0031258	lamellipodium membrane	The portion of the plasma membrane surrounding a lamellipodium.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031528	microvillus membrane	The portion of the plasma membrane surrounding a microvillus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031092	platelet alpha granule membrane	The lipid bilayer surrounding the platelet alpha granule.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (7, 36)

Sites (36, 36)

SS Bonds (37, 37)

Cis Peptide Bonds (18, 18)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (49, 98)

PROSITE Motifs (3, 16)

Exons (15, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (81, 99)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File