Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE T. THERMOPHILUS RNA POLYMERASE HOLOENZYME IN COMPLEX WITH ANTIBIOTIC RIFABUTIN
 
Authors :  I. Artsimovitch, M. N. Vassylyeva, D. Svetlov, V. Svetlov, A. Perederina, N. Igarashi, N. Matsugaki, S. Wakatsuki, T. H. Tahirov D. G. Vassylyev, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  01 Jul 05  (Deposition) - 20 Sep 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D,E,F,K,L,M,N,O,P
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  K,L,M,N,O,P  (1x)
Keywords :  Rna Polymerase Holoenzyme, Rifabutin, Antibiotic, Transcription Regulation, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Artsimovitch, M. N. Vassylyeva, D. Svetlov, V. Svetlov, A. Perederina, N. Igarashi, N. Matsugaki, S. Wakatsuki, T. H. Tahirov, D. G. Vassylyev
Allosteric Modulation Of The Rna Polymerase Catalytic Reaction Is An Essential Component Of Transcription Control By Rifamycins.
Cell(Cambridge, Mass. ) V. 122 351 2005
PubMed-ID: 16096056  |  Reference-DOI: 10.1016/J.CELL.2005.07.014
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
    ChainsA, B, K, L
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP ALPHA SUBUNIT, TRANSCRIPTASE ALPHA CHAIN, RNA POLYMERASE ALPHA SUBUNIT
 
Molecule 2 - DNA-DIRECTED RNA POLYMERASE BETA CHAIN
    ChainsC, M
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP BETA SUBUNIT, TRANSCRIPTASE BETA CHAIN, RNA POLYMERASE BETA SUBUNIT
 
Molecule 3 - DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    ChainsD, N
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP BETA' SUBUNIT, TRANSCRIPTASE BETA' CHAIN, RNA POLYMERASE BETA' SUBUNIT
 
Molecule 4 - RNA POLYMERASE OMEGA CHAIN
    ChainsE, O
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 5 - RNA POLYMERASE SIGMA FACTOR RPOD
    ChainsF, P
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFKLMNOP
Biological Unit 1 (1x)ABCDEF      
Biological Unit 2 (1x)      KLMNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 568)

Asymmetric Unit (3, 568)
No.NameCountTypeFull Name
1MG562Ligand/IonMAGNESIUM ION
2RBT2Ligand/IonRIFABUTIN
3ZN4Ligand/IonZINC ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2RBT1Ligand/IonRIFABUTIN
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2RBT1Ligand/IonRIFABUTIN
3ZN-1Ligand/IonZINC ION

(-) Sites  (445, 445)

Asymmetric Unit (445, 445)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREVAL A:170 , SER A:172 , HOH A:9637 , HOH A:9706BINDING SITE FOR RESIDUE MG A 9001
002AC2SOFTWAREPHE A:89 , ARG A:146 , HOH A:9615BINDING SITE FOR RESIDUE MG A 9018
003AC3SOFTWAREGLY A:105 , PRO A:106 , LEU A:132 , GLU A:133 , GLU A:134 , GLY A:135 , GLY A:136BINDING SITE FOR RESIDUE MG A 9024
004AC4SOFTWAREMG A:9126 , HOH A:9737BINDING SITE FOR RESIDUE MG A 9050
005AC5SOFTWAREASN A:227 , HOH A:9638BINDING SITE FOR RESIDUE MG A 9062
006AC6SOFTWARELEU A:208 , MG A:9165BINDING SITE FOR RESIDUE MG A 9097
007AC7SOFTWAREARG A:176BINDING SITE FOR RESIDUE MG A 9102
008AC8SOFTWAREARG A:176BINDING SITE FOR RESIDUE MG A 9107
009AC9SOFTWAREGLN A:213BINDING SITE FOR RESIDUE MG A 9109
010AD1SOFTWARESER F:272 , LEU F:308BINDING SITE FOR RESIDUE MG F 9153
011AD2SOFTWAREARG F:244BINDING SITE FOR RESIDUE MG F 9164
012AD3SOFTWAREGLU F:352BINDING SITE FOR RESIDUE MG F 9167
013AD4SOFTWARESER F:340 , VAL F:342BINDING SITE FOR RESIDUE MG F 9197
014AD5SOFTWAREHOH F:9708 , HOH F:9872BINDING SITE FOR RESIDUE MG F 9206
015AD6SOFTWARETYR C:1013 , ASP F:335 , LEU F:338 , PRO F:339 , SER F:340BINDING SITE FOR RESIDUE MG F 9407
016AD7SOFTWAREPRO F:153BINDING SITE FOR RESIDUE MG F 9410
017AD8SOFTWAREALA F:366 , LYS F:370 , HOH F:9610 , HOH F:9748BINDING SITE FOR RESIDUE MG F 9421
018AD9SOFTWAREGLY F:322BINDING SITE FOR RESIDUE MG F 9435
019BC1SOFTWAREHOH A:9744BINDING SITE FOR RESIDUE MG A 9116
020BC2SOFTWAREHOH A:9635 , HOH A:9636 , HOH A:9697 , HOH A:9734BINDING SITE FOR RESIDUE MG A 9117
021BC3SOFTWAREGLN A:229 , MG A:9050BINDING SITE FOR RESIDUE MG A 9126
022BC4SOFTWARESER A:66 , THR A:67BINDING SITE FOR RESIDUE MG A 9139
023BC5SOFTWAREARG N:414BINDING SITE FOR RESIDUE MG A 9145
024BC6SOFTWAREMG A:9097BINDING SITE FOR RESIDUE MG A 9165
025BC7SOFTWAREGLN A:16 , HOH A:9655BINDING SITE FOR RESIDUE MG A 9173
026BC8SOFTWAREARG A:176 , TRP A:200 , ASP C:863BINDING SITE FOR RESIDUE MG A 9178
027BC9SOFTWAREHOH A:9695BINDING SITE FOR RESIDUE MG A 9194
028BD1SOFTWAREHOH F:9727BINDING SITE FOR RESIDUE MG F 9461
029BD2SOFTWARETYR F:173 , LEU N:1311BINDING SITE FOR RESIDUE MG F 9465
030BD3SOFTWAREHOH F:9742BINDING SITE FOR RESIDUE MG F 9513
031BD4SOFTWAREVAL K:120 , ILE K:122BINDING SITE FOR RESIDUE MG K 9212
032BD5SOFTWARELYS K:83 , LEU K:85 , VAL K:170 , HOH K:6381BINDING SITE FOR RESIDUE MG K 9214
033BD6SOFTWAREARG K:88 , LEU K:90 , ASP K:119 , VAL K:120 , GLU K:121 , HOH K:3755BINDING SITE FOR RESIDUE MG K 9217
034BD7SOFTWAREPRO K:106BINDING SITE FOR RESIDUE MG K 9257
035BD8SOFTWAREARG K:137BINDING SITE FOR RESIDUE MG K 9264
036BD9SOFTWAREARG K:137BINDING SITE FOR RESIDUE MG K 9265
037CC1SOFTWARELEU A:186BINDING SITE FOR RESIDUE MG A 9200
038CC2SOFTWAREHOH A:9804BINDING SITE FOR RESIDUE MG A 9394
039CC3SOFTWARELEU A:80 , LYS A:83 , GLU A:84 , ASP C:698BINDING SITE FOR RESIDUE MG A 9411
040CC4SOFTWAREHOH A:9678BINDING SITE FOR RESIDUE MG A 9412
041CC5SOFTWAREARG A:137 , HOH A:9673 , HOH A:9736BINDING SITE FOR RESIDUE MG A 9413
042CC6SOFTWAREHOH A:9636BINDING SITE FOR RESIDUE MG A 9430
043CC7SOFTWAREHOH A:9657 , HOH A:9660BINDING SITE FOR RESIDUE MG A 9514
044CC8SOFTWAREHOH A:9767BINDING SITE FOR RESIDUE MG A 9522
045CC9SOFTWAREASP B:160 , ARG B:161BINDING SITE FOR RESIDUE MG B 9033
046CD1SOFTWAREGLN K:229 , HOH K:5334 , VAL L:13BINDING SITE FOR RESIDUE MG K 9279
047CD2SOFTWAREARG K:14 , THR K:15 , GLN K:16BINDING SITE FOR RESIDUE MG K 9351
048CD3SOFTWAREHOH K:4980BINDING SITE FOR RESIDUE MG K 9363
049CD4SOFTWAREASN K:227BINDING SITE FOR RESIDUE MG K 9367
050CD5SOFTWAREGLU K:220 , HIS K:221 , TYR K:224 , HOH K:6462BINDING SITE FOR RESIDUE MG K 9370
051CD6SOFTWAREHOH K:6433BINDING SITE FOR RESIDUE MG K 9484
052CD7SOFTWAREHOH K:3848BINDING SITE FOR RESIDUE MG K 9487
053CD8SOFTWARELYS K:159BINDING SITE FOR RESIDUE MG K 9492
054CD9SOFTWAREGLU K:154 , LYS M:750BINDING SITE FOR RESIDUE MG K 9495
055DC1SOFTWAREGLU B:104BINDING SITE FOR RESIDUE MG B 9040
056DC2SOFTWAREHOH A:9640 , ASN B:212 , GLU B:216 , HOH B:9766BINDING SITE FOR RESIDUE MG B 9079
057DC3SOFTWAREHOH B:9784BINDING SITE FOR RESIDUE MG B 9092
058DC4SOFTWARELEU B:45 , ARG B:175 , ARG B:176 , VAL B:177 , HOH B:9523BINDING SITE FOR RESIDUE MG B 9101
059DC5SOFTWAREGLU B:19 , HOH B:9651 , HOH B:9754BINDING SITE FOR RESIDUE MG B 9103
060DC6SOFTWAREASN B:38 , ARG B:41 , ARG B:42 , THR C:979 , GLU C:981BINDING SITE FOR RESIDUE MG B 9137
061DC7SOFTWARETRP B:200BINDING SITE FOR RESIDUE MG B 9146
062DC8SOFTWAREPRO B:106BINDING SITE FOR RESIDUE MG B 9148
063DC9SOFTWAREGLU B:216 , ARG B:219 , HOH B:9585 , HOH B:9760BINDING SITE FOR RESIDUE MG B 9150
064DD1SOFTWAREVAL K:13 , HOH K:6640 , GLN L:229BINDING SITE FOR RESIDUE MG L 9213
065DD2SOFTWAREARG L:14 , THR L:15BINDING SITE FOR RESIDUE MG L 9236
066DD3SOFTWAREHOH L:5043BINDING SITE FOR RESIDUE MG L 9249
067DD4SOFTWAREGLU L:141 , ASP L:160 , HOH L:4737 , HOH L:6438BINDING SITE FOR RESIDUE MG L 9258
068DD5SOFTWAREVAL L:120 , GLU L:121 , HOH L:5745 , MG L:9271BINDING SITE FOR RESIDUE MG L 9260
069DD6SOFTWAREHOH L:6809 , MG L:9260BINDING SITE FOR RESIDUE MG L 9271
070DD7SOFTWAREGLY L:187 , GLN L:188 , HOH N:2479BINDING SITE FOR RESIDUE MG L 9272
071DD8SOFTWARELEU L:101 , LYS L:102BINDING SITE FOR RESIDUE MG L 9278
072DD9SOFTWAREASN L:227 , HOH L:6200 , HOH L:6359 , HOH L:6500BINDING SITE FOR RESIDUE MG L 9299
073EC1SOFTWAREARG B:88 , HOH B:9692 , HOH B:9727 , HOH B:9789BINDING SITE FOR RESIDUE MG B 9163
074EC2SOFTWARETHR B:15 , GLN B:16 , GLY B:17 , HOH B:9690BINDING SITE FOR RESIDUE MG B 9176
075EC3SOFTWARETHR B:131 , LEU B:132BINDING SITE FOR RESIDUE MG B 9180
076EC4SOFTWAREHOH B:9730 , HOH B:9772BINDING SITE FOR RESIDUE MG B 9389
077EC5SOFTWAREHOH B:9552BINDING SITE FOR RESIDUE MG B 9391
078EC6SOFTWAREARG B:18BINDING SITE FOR RESIDUE MG B 9419
079EC7SOFTWAREGLN B:180BINDING SITE FOR RESIDUE MG B 9434
080EC8SOFTWAREHOH B:9649BINDING SITE FOR RESIDUE MG B 9442
081EC9SOFTWAREHOH B:9648 , HOH B:9704 , HOH B:9751BINDING SITE FOR RESIDUE MG B 9450
082ED1SOFTWARELEU L:90BINDING SITE FOR RESIDUE MG L 9300
083ED2SOFTWAREHOH D:2585 , HOH N:9942BINDING SITE FOR RESIDUE MG L 9311
084ED3SOFTWAREHOH D:9680BINDING SITE FOR RESIDUE MG L 9330
085ED4SOFTWAREHOH L:6659BINDING SITE FOR RESIDUE MG L 9345
086ED5SOFTWAREHOH L:5610BINDING SITE FOR RESIDUE MG L 9374
087ED6SOFTWAREHOH L:3952BINDING SITE FOR RESIDUE MG L 9480
088ED7SOFTWAREHOH L:5684BINDING SITE FOR RESIDUE MG L 9483
089ED8SOFTWAREMET L:1BINDING SITE FOR RESIDUE MG L 9532
090ED9SOFTWAREARG M:134 , GLN M:390 , LEU M:391 , SER M:392 , GLN M:393 , PHE M:394 , LYS M:395 , ASP M:396 , HIS M:406 , ARG M:409 , SER M:411 , LEU M:413 , PRO M:444 , ILE M:452 , HOH M:2356 , MG M:9334 , HOH M:9775 , ASP P:323 , LYS P:325BINDING SITE FOR RESIDUE RBT M 8002
091FC1SOFTWAREARG C:134 , GLN C:390 , SER C:392 , GLN C:393 , PHE C:394 , ASP C:396 , HIS C:406 , ARG C:409 , SER C:411 , HOH C:2056 , MG C:9025 , MG C:9063 , MG C:9083 , ASP F:323 , HOH F:9676 , HOH F:9904BINDING SITE FOR RESIDUE RBT C 8001
092FC2SOFTWAREPRO C:144 , LEU C:165 , ARG C:265 , TYR C:267 , HOH C:9833BINDING SITE FOR RESIDUE MG C 9004
093FC3SOFTWAREGLU C:491 , ASP C:492 , LYS C:518 , HOH C:9921BINDING SITE FOR RESIDUE MG C 9005
094FC4SOFTWARETYR A:20 , GLU A:22 , GLU C:932BINDING SITE FOR RESIDUE MG C 9007
095FC5SOFTWAREALA C:1007 , GLN C:1026 , PHE C:1027 , HOH C:9758 , GLU D:651 , HOH D:2468BINDING SITE FOR RESIDUE MG C 9011
096FC6SOFTWAREASP C:787BINDING SITE FOR RESIDUE MG C 9014
097FC7SOFTWARELEU C:1092 , LEU C:1097 , ASP C:1098 , VAL C:1099BINDING SITE FOR RESIDUE MG C 9020
098FC8SOFTWAREGLN C:219 , GLY C:220 , ASP C:223BINDING SITE FOR RESIDUE MG C 9022
099FC9SOFTWARELEU C:595 , TYR C:596 , HOH C:2295BINDING SITE FOR RESIDUE MG C 9023
100FD1SOFTWAREGLU M:740BINDING SITE FOR RESIDUE MG M 9210
101FD2SOFTWAREPRO M:793 , PRO M:794 , LYS M:1004 , HOH M:2221 , HOH M:9898BINDING SITE FOR RESIDUE MG M 9211
102FD3SOFTWAREGLY M:935 , VAL M:936BINDING SITE FOR RESIDUE MG M 9216
103FD4SOFTWAREALA M:213 , TYR M:214 , GLY M:215 , GLU M:216BINDING SITE FOR RESIDUE MG M 9219
104FD5SOFTWAREVAL M:743 , ARG M:744 , ILE M:745BINDING SITE FOR RESIDUE MG M 9220
105FD6SOFTWAREARG M:472 , ALA M:499 , ASP M:533 , HOH M:2114BINDING SITE FOR RESIDUE MG M 9222
106FD7SOFTWARELYS M:249BINDING SITE FOR RESIDUE MG M 9223
107FD8SOFTWAREPRO M:17 , GLU M:20 , GLU M:24 , HOH M:9932BINDING SITE FOR RESIDUE MG M 9224
108FD9SOFTWARELYS M:4 , HOH M:9942BINDING SITE FOR RESIDUE MG M 9227
109GC1SOFTWAREARG C:405 , ASN C:563 , RBT C:8001BINDING SITE FOR RESIDUE MG C 9025
110GC2SOFTWAREMET C:1035 , THR D:1088 , HOH D:2262BINDING SITE FOR RESIDUE MG C 9027
111GC3SOFTWAREGLU C:11 , VAL C:12 , ILE C:13 , PRO C:14BINDING SITE FOR RESIDUE MG C 9028
112GC4SOFTWAREARG C:274 , GLU C:278BINDING SITE FOR RESIDUE MG C 9029
113GC5SOFTWAREPHE C:1027BINDING SITE FOR RESIDUE MG C 9031
114GC6SOFTWAREARG C:154 , GLY C:156 , ARG C:157BINDING SITE FOR RESIDUE MG C 9044
115GC7SOFTWAREVAL C:181 , VAL C:182 , SER C:183 , HOH C:9874BINDING SITE FOR RESIDUE MG C 9046
116GC8SOFTWARETYR C:708 , PRO C:793 , PRO C:794 , GLY C:795 , GLU C:796BINDING SITE FOR RESIDUE MG C 9047
117GC9SOFTWAREALA C:29 , LEU C:30 , GLN C:31 , ILE C:44 , GLN C:45 , TYR C:71BINDING SITE FOR RESIDUE MG C 9056
118GD1SOFTWAREARG M:630 , HOH M:2011 , HOH M:2124 , HOH M:2219 , HOH M:2236BINDING SITE FOR RESIDUE MG M 9229
119GD2SOFTWAREPRO M:244BINDING SITE FOR RESIDUE MG M 9233
120GD3SOFTWAREARG M:460 , HOH M:2411 , HOH M:9945BINDING SITE FOR RESIDUE MG M 9241
121GD4SOFTWAREGLU M:56BINDING SITE FOR RESIDUE MG M 9243
122GD5SOFTWARETHR M:803 , HOH M:2157 , HOH M:9586BINDING SITE FOR RESIDUE MG M 9251
123GD6SOFTWAREGLY M:618BINDING SITE FOR RESIDUE MG M 9252
124GD7SOFTWARETYR M:895 , HOH M:2197 , MG M:9309BINDING SITE FOR RESIDUE MG M 9254
125GD8SOFTWAREPRO M:77BINDING SITE FOR RESIDUE MG M 9255
126GD9SOFTWAREASP M:251BINDING SITE FOR RESIDUE MG M 9259
127HC1SOFTWARERBT C:8001 , HOH C:9674BINDING SITE FOR RESIDUE MG C 9063
128HC2SOFTWAREPRO C:166 , ARG C:168BINDING SITE FOR RESIDUE MG C 9068
129HC3SOFTWAREARG C:820 , HOH C:2214BINDING SITE FOR RESIDUE MG C 9074
130HC4SOFTWARELEU C:815 , LYS C:816 , PRO C:817 , HOH C:9973 , TYR F:288BINDING SITE FOR RESIDUE MG C 9076
131HC5SOFTWARELYS C:957 , THR C:958 , GLU C:961BINDING SITE FOR RESIDUE MG C 9081
132HC6SOFTWARERBT C:8001BINDING SITE FOR RESIDUE MG C 9083
133HC7SOFTWAREHOH C:2228BINDING SITE FOR RESIDUE MG C 9086
134HC8SOFTWAREPRO C:231BINDING SITE FOR RESIDUE MG C 9106
135HC9SOFTWAREHOH C:9724BINDING SITE FOR RESIDUE MG C 9113
136HD1SOFTWARETRP M:171BINDING SITE FOR RESIDUE MG M 9261
137HD2SOFTWAREMG M:9298BINDING SITE FOR RESIDUE MG M 9267
138HD3SOFTWARETYR M:629 , HOH M:2183BINDING SITE FOR RESIDUE MG M 9268
139HD4SOFTWARETYR M:895 , HOH M:2247 , HOH M:9808BINDING SITE FOR RESIDUE MG M 9276
140HD5SOFTWAREASN M:41 , ALA M:46 , HOH M:2177 , HOH M:2275BINDING SITE FOR RESIDUE MG M 9283
141HD6SOFTWAREARG M:383 , HOH M:9882BINDING SITE FOR RESIDUE MG M 9285
142HD7SOFTWAREPRO M:912 , HOH M:9940BINDING SITE FOR RESIDUE MG M 9290
143HD8SOFTWAREHIS M:1006 , PHE M:1027 , GLY M:1028BINDING SITE FOR RESIDUE MG M 9293
144HD9SOFTWAREMET M:1 , MG M:9267BINDING SITE FOR RESIDUE MG M 9298
145IC1SOFTWAREPHE C:906 , LYS C:910 , GLY D:1064BINDING SITE FOR RESIDUE MG C 9121
146IC2SOFTWAREARG C:713 , ASP C:714 , HOH C:9872 , GLY D:532BINDING SITE FOR RESIDUE MG C 9124
147IC3SOFTWAREPRO C:318BINDING SITE FOR RESIDUE MG C 9127
148IC4SOFTWAREASP C:857BINDING SITE FOR RESIDUE MG C 9130
149IC5SOFTWAREARG C:5 , GLU C:11 , THR C:581 , PRO C:904 , MG C:9431BINDING SITE FOR RESIDUE MG C 9144
150IC6SOFTWAREARG C:266 , ARG C:345BINDING SITE FOR RESIDUE MG C 9156
151IC7SOFTWAREGLU C:297 , HOH C:2284BINDING SITE FOR RESIDUE MG C 9157
152IC8SOFTWAREGLU C:602 , HOH C:2134BINDING SITE FOR RESIDUE MG C 9160
153IC9SOFTWAREASP C:1075 , SER D:752 , SER D:753BINDING SITE FOR RESIDUE MG C 9161
154ID1SOFTWAREMG M:9254BINDING SITE FOR RESIDUE MG M 9309
155ID2SOFTWARELEU M:464BINDING SITE FOR RESIDUE MG M 9312
156ID3SOFTWAREHOH M:2138BINDING SITE FOR RESIDUE MG M 9321
157ID4SOFTWARELYS M:1090 , ALA M:1116BINDING SITE FOR RESIDUE MG M 9323
158ID5SOFTWAREASP M:104 , THR M:105BINDING SITE FOR RESIDUE MG M 9328
159ID6SOFTWAREGLU M:82BINDING SITE FOR RESIDUE MG M 9331
160ID7SOFTWARERBT M:8002 , HOH M:9812BINDING SITE FOR RESIDUE MG M 9334
161ID8SOFTWAREGLU M:598 , MG M:9481BINDING SITE FOR RESIDUE MG M 9336
162ID9SOFTWAREHOH C:2519BINDING SITE FOR RESIDUE MG M 9348
163JC1SOFTWAREHIS C:1047 , PHE D:754BINDING SITE FOR RESIDUE MG C 9170
164JC2SOFTWAREGLN C:829 , LYS C:830 , ARG C:831 , LYS C:832 , HOH C:9978BINDING SITE FOR RESIDUE MG C 9171
165JC3SOFTWAREARG C:243 , PRO C:244 , HOH C:2035BINDING SITE FOR RESIDUE MG C 9177
166JC4SOFTWAREHOH C:9550BINDING SITE FOR RESIDUE MG C 9185
167JC5SOFTWAREARG C:939 , HOH C:9677 , HOH D:2591BINDING SITE FOR RESIDUE MG C 9190
168JC6SOFTWAREHOH C:9959BINDING SITE FOR RESIDUE MG C 9192
169JC7SOFTWAREGLY C:933BINDING SITE FOR RESIDUE MG C 9198
170JC8SOFTWAREGLU C:511 , HOH C:2333BINDING SITE FOR RESIDUE MG C 9201
171JC9SOFTWAREARG C:422BINDING SITE FOR RESIDUE MG C 9204
172JD1SOFTWAREASP M:481 , ASN M:506 , HOH M:2175BINDING SITE FOR RESIDUE MG M 9350
173JD2SOFTWAREGLN M:1100 , ARG N:9BINDING SITE FOR RESIDUE MG M 9364
174JD3SOFTWAREMG M:9537BINDING SITE FOR RESIDUE MG M 9369
175JD4SOFTWAREILE M:1111BINDING SITE FOR RESIDUE MG M 9372
176JD5SOFTWARELYS M:716BINDING SITE FOR RESIDUE MG M 9373
177JD6SOFTWAREHIS F:263 , HOH F:9580 , HOH F:9740BINDING SITE FOR RESIDUE MG M 9380
178JD7SOFTWAREHOH M:2272 , HOH M:2394BINDING SITE FOR RESIDUE MG M 9382
179JD8SOFTWAREHOH M:9888BINDING SITE FOR RESIDUE MG M 9383
180JD9SOFTWAREHOH M:2148BINDING SITE FOR RESIDUE MG M 9384
181KC1SOFTWARELEU C:673 , ASP C:868 , TYR C:895BINDING SITE FOR RESIDUE MG C 9398
182KC2SOFTWARELYS C:1072 , GLY C:1073BINDING SITE FOR RESIDUE MG C 9399
183KC3SOFTWAREHOH C:2041BINDING SITE FOR RESIDUE MG C 9408
184KC4SOFTWAREHIS C:728 , LYS C:762BINDING SITE FOR RESIDUE MG C 9414
185KC5SOFTWAREARG C:308 , HOH C:9763BINDING SITE FOR RESIDUE MG C 9415
186KC6SOFTWAREALA C:555 , ASN C:556 , HOH C:9592BINDING SITE FOR RESIDUE MG C 9420
187KC7SOFTWAREHIS C:320 , VAL C:322BINDING SITE FOR RESIDUE MG C 9426
188KC8SOFTWAREARG C:230BINDING SITE FOR RESIDUE MG C 9428
189KC9SOFTWAREARG C:5 , GLY C:7 , GLU C:11 , PRO C:904 , MG C:9144BINDING SITE FOR RESIDUE MG C 9431
190KD1SOFTWAREHOH M:9768BINDING SITE FOR RESIDUE MG M 9385
191KD2SOFTWAREHOH M:2217 , HOH M:2502BINDING SITE FOR RESIDUE MG M 9472
192KD3SOFTWAREARG M:209 , GLU M:210 , HOH M:9722BINDING SITE FOR RESIDUE MG M 9473
193KD4SOFTWAREARG M:27 , LEU M:30 , GLN M:31 , ASP M:33BINDING SITE FOR RESIDUE MG M 9478
194KD5SOFTWAREGLU M:598 , MG M:9336BINDING SITE FOR RESIDUE MG M 9481
195KD6SOFTWAREGLN M:567 , LYS M:838 , TYR M:998BINDING SITE FOR RESIDUE MG M 9485
196KD7SOFTWAREGLY M:951BINDING SITE FOR RESIDUE MG M 9488
197KD8SOFTWAREGLU M:780BINDING SITE FOR RESIDUE MG M 9497
198KD9SOFTWAREARG M:939BINDING SITE FOR RESIDUE MG M 9500
199LC1SOFTWAREHOH C:2039 , HOH C:2524BINDING SITE FOR RESIDUE MG C 9439
200LC2SOFTWAREHOH C:2228BINDING SITE FOR RESIDUE MG C 9455
201LC3SOFTWARELEU C:120 , MET C:121 , HOH C:2034BINDING SITE FOR RESIDUE MG C 9456
202LC4SOFTWAREHOH C:2109 , HOH C:2177BINDING SITE FOR RESIDUE MG C 9457
203LC5SOFTWAREHOH C:2540 , HOH C:9694BINDING SITE FOR RESIDUE MG C 9458
204LC6SOFTWAREHOH C:2510 , HOH C:9558BINDING SITE FOR RESIDUE MG C 9462
205LC7SOFTWAREGLU C:1061 , GLY C:1062 , ALA C:1065BINDING SITE FOR RESIDUE MG C 9515
206LC8SOFTWAREHOH C:2433BINDING SITE FOR RESIDUE MG C 9521
207LC9SOFTWARELYS C:109 , HOH C:9676 , HOH C:9715BINDING SITE FOR RESIDUE MG C 9546
208LD1SOFTWAREMG M:9369BINDING SITE FOR RESIDUE MG M 9537
209LD2SOFTWARECYS N:58 , CYS N:60 , CYS N:73 , CYS N:76BINDING SITE FOR RESIDUE ZN N 7059
210LD3SOFTWARECYS N:1112 , CYS N:1194 , CYS N:1201 , CYS N:1204BINDING SITE FOR RESIDUE ZN N 7113
211LD4SOFTWAREPRO N:706 , THR N:707 , LEU N:708 , GLY N:712 , HOH N:2103BINDING SITE FOR RESIDUE MG N 9207
212LD5SOFTWAREALA N:1438 , SER N:1439 , PHE N:1440 , THR N:1443BINDING SITE FOR RESIDUE MG N 9208
213LD6SOFTWAREGLY N:164 , LYS N:165 , VAL N:447 , GLU N:448 , SER N:449 , HOH N:9723BINDING SITE FOR RESIDUE MG N 9215
214LD7SOFTWAREHOH L:4578 , ARG N:884BINDING SITE FOR RESIDUE MG N 9218
215LD8SOFTWAREVAL N:179 , VAL N:213BINDING SITE FOR RESIDUE MG N 9221
216LD9SOFTWAREILE N:1183BINDING SITE FOR RESIDUE MG N 9225
217MC1SOFTWAREHOH C:2295BINDING SITE FOR RESIDUE MG C 9549
218MC2SOFTWARECYS D:58 , CYS D:60 , CYS D:73 , CYS D:76BINDING SITE FOR RESIDUE ZN D 7058
219MC3SOFTWARECYS D:1112 , ARG D:1189 , CYS D:1194 , CYS D:1201 , CYS D:1204BINDING SITE FOR RESIDUE ZN D 7112
220MC4SOFTWARETYR D:23 , GLY D:24 , GLU D:25 , VAL D:26 , ILE D:49 , HIS D:92BINDING SITE FOR RESIDUE MG D 9002
221MC5SOFTWARELYS D:131 , ILE D:133 , ASP D:155 , MET D:456BINDING SITE FOR RESIDUE MG D 9003
222MC6SOFTWAREALA D:1089 , TYR D:1093 , ARG D:1096BINDING SITE FOR RESIDUE MG D 9006
223MC7SOFTWAREARG D:710 , PRO D:772 , TYR D:1205 , ASP D:1208 , GLU D:1219 , VAL D:1224BINDING SITE FOR RESIDUE MG D 9008
224MC8SOFTWARETHR D:1237 , HOH D:2267 , HOH D:2776 , HOH D:9639BINDING SITE FOR RESIDUE MG D 9009
225MC9SOFTWAREGLU D:79 , VAL D:80 , THR D:81 , LYS D:82 , VAL D:85BINDING SITE FOR RESIDUE MG D 9012
226MD1SOFTWARELEU N:804 , ALA N:830 , GLY N:831BINDING SITE FOR RESIDUE MG N 9226
227MD2SOFTWARELEU N:191 , VAL N:195BINDING SITE FOR RESIDUE MG N 9228
228MD3SOFTWAREARG N:220 , ALA N:369BINDING SITE FOR RESIDUE MG N 9230
229MD4SOFTWAREPHE N:656 , VAL N:694 , LYS N:698BINDING SITE FOR RESIDUE MG N 9232
230MD5SOFTWAREGLY N:188 , ARG N:441 , HOH N:2363BINDING SITE FOR RESIDUE MG N 9238
231MD6SOFTWAREASP N:952 , ALA N:954 , VAL N:955 , ILE N:956BINDING SITE FOR RESIDUE MG N 9242
232MD7SOFTWAREGLN N:901 , LEU N:902 , ASP N:903 , HOH N:9676BINDING SITE FOR RESIDUE MG N 9244
233MD8SOFTWAREGLY N:1030 , ASN N:1031 , GLN N:1034 , HOH N:2889BINDING SITE FOR RESIDUE MG N 9245
234MD9SOFTWAREGLU N:1410 , GLY N:1411BINDING SITE FOR RESIDUE MG N 9246
235NC1SOFTWARELYS C:949 , ARG D:796 , PHE D:1017 , HOH D:2522BINDING SITE FOR RESIDUE MG D 9013
236NC2SOFTWAREVAL C:1109 , HOH C:9926 , LYS D:2 , LYS D:3BINDING SITE FOR RESIDUE MG D 9015
237NC3SOFTWARELEU D:1407BINDING SITE FOR RESIDUE MG D 9016
238NC4SOFTWAREALA D:13 , SER D:14 , PRO D:15 , ILE D:18BINDING SITE FOR RESIDUE MG D 9017
239NC5SOFTWAREALA D:589 , MG D:9169BINDING SITE FOR RESIDUE MG D 9019
240NC6SOFTWAREASP D:741 , GLY D:742BINDING SITE FOR RESIDUE MG D 9021
241NC7SOFTWAREPHE D:1017 , ASN D:1018 , PRO D:1019 , HOH D:2653BINDING SITE FOR RESIDUE MG D 9026
242NC8SOFTWAREALA D:100 , MET D:512 , ILE D:513 , HOH D:2526BINDING SITE FOR RESIDUE MG D 9036
243NC9SOFTWARETYR D:63 , LYS D:71 , VAL D:72 , CYS D:73BINDING SITE FOR RESIDUE MG D 9037
244ND1SOFTWAREHOH M:2153 , THR N:1088 , ALA N:1089BINDING SITE FOR RESIDUE MG N 9247
245ND2SOFTWAREGLU N:1410 , GLY N:1411 , LYS N:1412BINDING SITE FOR RESIDUE MG N 9248
246ND3SOFTWAREMG N:9506BINDING SITE FOR RESIDUE MG N 9250
247ND4SOFTWARELYS N:428 , SER N:429 , TYR N:450BINDING SITE FOR RESIDUE MG N 9253
248ND5SOFTWARELYS N:138BINDING SITE FOR RESIDUE MG N 9256
249ND6SOFTWAREGLU N:510BINDING SITE FOR RESIDUE MG N 9262
250ND7SOFTWARELEU N:387 , HIS N:388 , GLU N:389BINDING SITE FOR RESIDUE MG N 9263
251ND8SOFTWAREASN N:1031 , GLN N:1033 , GLN N:1034 , GLN N:1037 , MG N:9314BINDING SITE FOR RESIDUE MG N 9266
252ND9SOFTWAREGLN N:1235BINDING SITE FOR RESIDUE MG N 9273
253OC1SOFTWARELYS D:871 , ARG D:872 , HOH D:9625BINDING SITE FOR RESIDUE MG D 9038
254OC2SOFTWAREGLN D:125 , TYR D:132BINDING SITE FOR RESIDUE MG D 9041
255OC3SOFTWAREALA L:153 , GLU L:154 , GLY L:157BINDING SITE FOR RESIDUE MG D 9042
256OC4SOFTWAREALA D:1343BINDING SITE FOR RESIDUE MG D 9049
257OC5SOFTWARESER D:608 , GLY D:609BINDING SITE FOR RESIDUE MG D 9051
258OC6SOFTWAREALA D:370 , ILE D:371 , ASP D:372 , PRO D:373BINDING SITE FOR RESIDUE MG D 9052
259OC7SOFTWAREGLU D:1231BINDING SITE FOR RESIDUE MG D 9055
260OC8SOFTWAREVAL D:175 , LEU D:387 , HOH D:2002 , HOH D:2185BINDING SITE FOR RESIDUE MG D 9057
261OC9SOFTWAREARG D:1327 , HOH D:2163BINDING SITE FOR RESIDUE MG D 9058
262OD1SOFTWAREARG N:546 , ASN N:593 , SER P:208BINDING SITE FOR RESIDUE MG N 9277
263OD2SOFTWARETHR N:1000 , GLY N:1043BINDING SITE FOR RESIDUE MG N 9280
264OD3SOFTWARETYR N:401BINDING SITE FOR RESIDUE MG N 9281
265OD4SOFTWARELYS N:131 , TYR N:132 , ASP N:155 , HOH N:9994BINDING SITE FOR RESIDUE MG N 9282
266OD5SOFTWAREHOH N:2770BINDING SITE FOR RESIDUE MG N 9286
267OD6SOFTWARELYS N:684 , GLU N:686BINDING SITE FOR RESIDUE MG N 9288
268OD7SOFTWARETYR N:1165 , GLN N:1202 , HOH N:2254BINDING SITE FOR RESIDUE MG N 9289
269OD8SOFTWARELYS N:799 , HOH N:9770BINDING SITE FOR RESIDUE MG N 9291
270OD9SOFTWAREASP N:952BINDING SITE FOR RESIDUE MG N 9292
271PC1SOFTWAREGLU D:25 , LYS D:555 , HOH D:2656BINDING SITE FOR RESIDUE MG D 9059
272PC2SOFTWAREGLU D:476BINDING SITE FOR RESIDUE MG D 9060
273PC3SOFTWAREHOH D:2498 , MG D:9125BINDING SITE FOR RESIDUE MG D 9061
274PC4SOFTWAREGLN D:636 , HOH D:2261BINDING SITE FOR RESIDUE MG D 9064
275PC5SOFTWAREARG D:1267BINDING SITE FOR RESIDUE MG D 9066
276PC6SOFTWARELYS D:1136BINDING SITE FOR RESIDUE MG D 9067
277PC7SOFTWAREILE A:122 , GLU D:1154 , HOH D:2056BINDING SITE FOR RESIDUE MG D 9069
278PC8SOFTWAREGLN D:680BINDING SITE FOR RESIDUE MG D 9070
279PC9SOFTWAREALA D:381BINDING SITE FOR RESIDUE MG D 9073
280PD1SOFTWAREHOH N:2565BINDING SITE FOR RESIDUE MG N 9294
281PD2SOFTWARELYS N:2 , HOH N:2204BINDING SITE FOR RESIDUE MG N 9295
282PD3SOFTWAREVAL N:530 , ASP N:531BINDING SITE FOR RESIDUE MG N 9301
283PD4SOFTWAREHOH D:9984BINDING SITE FOR RESIDUE MG N 9302
284PD5SOFTWAREHOH N:2498 , HOH N:9760BINDING SITE FOR RESIDUE MG N 9303
285PD6SOFTWAREGLU N:1162BINDING SITE FOR RESIDUE MG N 9305
286PD7SOFTWARESER N:1387 , GLU N:1391 , GLN N:1393BINDING SITE FOR RESIDUE MG N 9307
287PD8SOFTWARETHR N:97 , LYS N:571BINDING SITE FOR RESIDUE MG N 9308
288PD9SOFTWAREGLN N:125 , ARG N:587 , LYS P:74BINDING SITE FOR RESIDUE MG N 9310
289QC1SOFTWARELEU D:1395 , ASP D:1399 , HOH D:2287BINDING SITE FOR RESIDUE MG D 9075
290QC2SOFTWARELYS D:664 , HOH D:2373BINDING SITE FOR RESIDUE MG D 9077
291QC3SOFTWAREGLU D:1337BINDING SITE FOR RESIDUE MG D 9082
292QC4SOFTWARELYS D:1002 , GLN D:1005BINDING SITE FOR RESIDUE MG D 9084
293QC5SOFTWAREILE D:1408 , HOH D:2574BINDING SITE FOR RESIDUE MG D 9085
294QC6SOFTWAREARG D:546 , HOH F:9948BINDING SITE FOR RESIDUE MG D 9087
295QC7SOFTWAREHOH D:2249BINDING SITE FOR RESIDUE MG D 9090
296QC8SOFTWAREHOH D:2364BINDING SITE FOR RESIDUE MG D 9091
297QC9SOFTWAREHOH C:2109BINDING SITE FOR RESIDUE MG D 9093
298QD1SOFTWAREASP N:451 , ASP N:453BINDING SITE FOR RESIDUE MG N 9313
299QD2SOFTWAREASN N:1031 , GLN N:1034 , MG N:9266BINDING SITE FOR RESIDUE MG N 9314
300QD3SOFTWARELYS N:1339BINDING SITE FOR RESIDUE MG N 9315
301QD4SOFTWAREASP N:504 , HOH N:2189 , HOH N:2526BINDING SITE FOR RESIDUE MG N 9319
302QD5SOFTWAREARG N:441BINDING SITE FOR RESIDUE MG N 9320
303QD6SOFTWAREGLU N:1013BINDING SITE FOR RESIDUE MG N 9324
304QD7SOFTWAREGLY N:144 , VAL N:145BINDING SITE FOR RESIDUE MG N 9327
305QD8SOFTWAREGLN N:1195 , HOH N:2159BINDING SITE FOR RESIDUE MG N 9335
306QD9SOFTWAREPRO N:668 , HOH P:5183BINDING SITE FOR RESIDUE MG N 9338
307RC1SOFTWAREARG N:75 , HOH N:2164BINDING SITE FOR RESIDUE MG D 9094
308RC2SOFTWAREPRO D:957 , GLU D:958BINDING SITE FOR RESIDUE MG D 9095
309RC3SOFTWAREHOH D:9979BINDING SITE FOR RESIDUE MG D 9096
310RC4SOFTWARELYS D:1176 , HOH D:2264BINDING SITE FOR RESIDUE MG D 9099
311RC5SOFTWAREASP D:583 , ARG D:586 , THR D:1444BINDING SITE FOR RESIDUE MG D 9100
312RC6SOFTWAREGLN D:794 , LYS D:797BINDING SITE FOR RESIDUE MG D 9104
313RC7SOFTWARELYS D:1307 , GLU D:1308 , ALA D:1309 , ARG D:1310 , HOH P:5126BINDING SITE FOR RESIDUE MG D 9105
314RC8SOFTWARELEU D:242 , TYR D:249BINDING SITE FOR RESIDUE MG D 9108
315RC9SOFTWARELEU D:823BINDING SITE FOR RESIDUE MG D 9110
316RD1SOFTWAREGLU N:805 , HOH N:2080BINDING SITE FOR RESIDUE MG N 9339
317RD2SOFTWAREARG N:35BINDING SITE FOR RESIDUE MG N 9342
318RD3SOFTWAREARG N:75BINDING SITE FOR RESIDUE MG N 9343
319RD4SOFTWAREASP N:405 , GLU N:408 , VAL N:409BINDING SITE FOR RESIDUE MG N 9349
320RD5SOFTWAREASP N:504 , SER N:505BINDING SITE FOR RESIDUE MG N 9352
321RD6SOFTWAREASP N:531 , GLY N:532 , HOH N:9751BINDING SITE FOR RESIDUE MG N 9354
322RD7SOFTWARELYS N:1271BINDING SITE FOR RESIDUE MG N 9357
323RD8SOFTWARELYS N:71 , HOH N:2766 , MG N:9506BINDING SITE FOR RESIDUE MG N 9360
324RD9SOFTWAREHIS N:1242 , ARG N:1266BINDING SITE FOR RESIDUE MG N 9365
325SC1SOFTWAREASP D:542 , THR D:592 , ASN D:593BINDING SITE FOR RESIDUE MG D 9111
326SC2SOFTWARESER D:1167 , ASP D:1169BINDING SITE FOR RESIDUE MG D 9112
327SC3SOFTWAREARG D:675 , HOH D:2151 , ARG F:419BINDING SITE FOR RESIDUE MG D 9118
328SC4SOFTWAREARG D:796 , GLN D:861BINDING SITE FOR RESIDUE MG D 9120
329SC5SOFTWARETHR D:997 , THR D:1000 , GLU D:1001 , HOH D:2587BINDING SITE FOR RESIDUE MG D 9122
330SC6SOFTWAREVAL D:216 , LYS D:217 , ASP D:372BINDING SITE FOR RESIDUE MG D 9123
331SC7SOFTWAREHOH D:2313 , MG D:9061BINDING SITE FOR RESIDUE MG D 9125
332SC8SOFTWAREALA D:120 , MG D:9446BINDING SITE FOR RESIDUE MG D 9128
333SC9SOFTWARETYR D:215 , LEU D:227 , GLU D:375BINDING SITE FOR RESIDUE MG D 9129
334SD1SOFTWARELEU N:823 , HOH N:2117BINDING SITE FOR RESIDUE MG N 9368
335SD2SOFTWAREASP N:469 , HOH N:9597BINDING SITE FOR RESIDUE MG N 9371
336SD3SOFTWAREHOH D:2254BINDING SITE FOR RESIDUE MG N 9375
337SD4SOFTWAREHOH M:2182 , VAL N:853BINDING SITE FOR RESIDUE MG N 9381
338SD5SOFTWAREHOH N:2080 , HOH N:2313 , HOH N:2794BINDING SITE FOR RESIDUE MG N 9386
339SD6SOFTWAREGLU N:40 , HOH N:9959BINDING SITE FOR RESIDUE MG N 9387
340SD7SOFTWAREHOH N:2236 , MG N:9528BINDING SITE FOR RESIDUE MG N 9470
341SD8SOFTWAREMG F:9045 , LYS N:1307 , GLU N:1308BINDING SITE FOR RESIDUE MG N 9475
342SD9SOFTWAREHOH F:9892BINDING SITE FOR RESIDUE MG N 9476
343TC1SOFTWAREGLU D:965BINDING SITE FOR RESIDUE MG D 9132
344TC2SOFTWAREVAL D:591BINDING SITE FOR RESIDUE MG D 9134
345TC3SOFTWARETYR D:1318 , GLN D:1323BINDING SITE FOR RESIDUE MG D 9138
346TC4SOFTWAREGLU D:998BINDING SITE FOR RESIDUE MG D 9142
347TC5SOFTWAREGLN D:636 , GLN D:727BINDING SITE FOR RESIDUE MG D 9147
348TC6SOFTWAREGLU D:958BINDING SITE FOR RESIDUE MG D 9149
349TC7SOFTWAREGLU D:480 , PRO D:484BINDING SITE FOR RESIDUE MG D 9152
350TC8SOFTWAREASN D:909 , LYS D:912BINDING SITE FOR RESIDUE MG D 9154
351TC9SOFTWARELYS D:1339BINDING SITE FOR RESIDUE MG D 9158
352TD1SOFTWAREGLU N:663 , LYS N:664BINDING SITE FOR RESIDUE MG N 9482
353TD2SOFTWAREILE N:857BINDING SITE FOR RESIDUE MG N 9486
354TD3SOFTWAREHOH P:5183 , HOH P:6288BINDING SITE FOR RESIDUE MG N 9498
355TD4SOFTWARELYS N:54BINDING SITE FOR RESIDUE MG N 9501
356TD5SOFTWAREGLU N:1069BINDING SITE FOR RESIDUE MG N 9504
357TD6SOFTWAREVAL N:72 , HOH N:2766 , MG N:9250 , MG N:9360BINDING SITE FOR RESIDUE MG N 9506
358TD7SOFTWAREGLU N:722 , GLY N:723BINDING SITE FOR RESIDUE MG N 9508
359TD8SOFTWAREARG L:185BINDING SITE FOR RESIDUE MG N 9509
360TD9SOFTWARELEU N:708 , THR N:1088 , SER N:1091BINDING SITE FOR RESIDUE MG N 9526
361UC1SOFTWAREHOH E:9590BINDING SITE FOR RESIDUE MG D 9159
362UC2SOFTWAREPRO D:248 , PHE D:251 , HOH D:2925BINDING SITE FOR RESIDUE MG D 9162
363UC3SOFTWAREPHE D:207BINDING SITE FOR RESIDUE MG D 9166
364UC4SOFTWAREARG D:1096 , PHE D:1440BINDING SITE FOR RESIDUE MG D 9168
365UC5SOFTWAREALA D:589 , MG D:9019BINDING SITE FOR RESIDUE MG D 9169
366UC6SOFTWAREVAL D:1486 , VAL D:1487 , THR D:1491BINDING SITE FOR RESIDUE MG D 9172
367UC7SOFTWAREHOH D:2580 , HOH D:9967BINDING SITE FOR RESIDUE MG D 9174
368UC8SOFTWAREHOH D:2556BINDING SITE FOR RESIDUE MG D 9175
369UC9SOFTWAREPHE D:919 , LEU D:920BINDING SITE FOR RESIDUE MG D 9179
370UD1SOFTWAREMG N:9470BINDING SITE FOR RESIDUE MG N 9528
371UD2SOFTWARELEU N:540 , HOH P:5327BINDING SITE FOR RESIDUE MG N 9531
372UD3SOFTWAREHOH C:2288BINDING SITE FOR RESIDUE MG N 9533
373UD4SOFTWAREHOH N:9807BINDING SITE FOR RESIDUE MG N 9534
374UD5SOFTWAREARG N:832BINDING SITE FOR RESIDUE MG N 9539
375UD6SOFTWARETHR N:1004 , GLN N:1033 , HOH N:2721BINDING SITE FOR RESIDUE MG N 9550
376UD7SOFTWAREHOH N:2321 , HOH N:2627 , MG N:9554BINDING SITE FOR RESIDUE MG N 9551
377UD8SOFTWAREHOH N:2574 , HOH N:2908BINDING SITE FOR RESIDUE MG N 9552
378UD9SOFTWAREHOH N:2627 , HOH N:2881 , MG N:9551BINDING SITE FOR RESIDUE MG N 9554
379VC1SOFTWAREILE D:1283 , GLU D:1284 , ASP D:1315 , LYS P:168 , GLU P:169BINDING SITE FOR RESIDUE MG D 9181
380VC2SOFTWAREASN D:1014BINDING SITE FOR RESIDUE MG D 9182
381VC3SOFTWAREGLU D:1179 , MG D:9416BINDING SITE FOR RESIDUE MG D 9188
382VC4SOFTWAREGLU D:1449BINDING SITE FOR RESIDUE MG D 9189
383VC5SOFTWARELYS D:149 , ARG D:150 , HOH D:2471BINDING SITE FOR RESIDUE MG D 9195
384VC6SOFTWARELYS D:961 , HOH D:2441BINDING SITE FOR RESIDUE MG D 9202
385VC7SOFTWAREGLU D:1152 , ARG D:1159BINDING SITE FOR RESIDUE MG D 9203
386VC8SOFTWAREASN D:1404 , HOH D:2176BINDING SITE FOR RESIDUE MG D 9397
387VC9SOFTWARELYS D:491 , HOH D:9968BINDING SITE FOR RESIDUE MG D 9401
388VD1SOFTWAREHOH N:2784 , THR O:50BINDING SITE FOR RESIDUE MG O 9209
389VD2SOFTWAREPRO O:94BINDING SITE FOR RESIDUE MG O 9231
390VD3SOFTWAREGLU N:925 , HOH N:2342 , PRO O:4BINDING SITE FOR RESIDUE MG O 9337
391VD4SOFTWAREPRO O:42BINDING SITE FOR RESIDUE MG O 9355
392VD5SOFTWAREARG O:91BINDING SITE FOR RESIDUE MG O 9359
393VD6SOFTWAREGLU O:41 , PRO O:42BINDING SITE FOR RESIDUE MG O 9362
394VD7SOFTWAREARG N:613 , GLU P:318 , HOH P:5327BINDING SITE FOR RESIDUE MG P 9239
395VD8SOFTWAREVAL P:106 , GLY P:109 , MET P:110BINDING SITE FOR RESIDUE MG P 9240
396VD9SOFTWAREGLU P:149 , MG P:9284BINDING SITE FOR RESIDUE MG P 9269
397WC1SOFTWAREGLU D:1127BINDING SITE FOR RESIDUE MG D 9403
398WC2SOFTWAREMG D:9188BINDING SITE FOR RESIDUE MG D 9416
399WC3SOFTWAREASP D:1090 , PHE D:1241 , MG D:9433BINDING SITE FOR RESIDUE MG D 9423
400WC4SOFTWAREARG D:159 , GLU F:87 , MG F:9032BINDING SITE FOR RESIDUE MG D 9425
401WC5SOFTWAREMG D:9423BINDING SITE FOR RESIDUE MG D 9433
402WC6SOFTWAREGLY D:77 , VAL D:78BINDING SITE FOR RESIDUE MG D 9441
403WC7SOFTWAREASP D:903 , HOH D:2716BINDING SITE FOR RESIDUE MG D 9443
404WC8SOFTWARELEU D:118 , HOH D:2949 , MG D:9128BINDING SITE FOR RESIDUE MG D 9446
405WC9SOFTWARELEU D:245 , PRO D:246 , ILE D:367 , HOH D:9672 , HOH D:9826BINDING SITE FOR RESIDUE MG D 9449
406WD1SOFTWAREVAL P:368 , ALA P:388 , PHE P:389 , PHE P:390 , HOH P:5416BINDING SITE FOR RESIDUE MG P 9274
407WD2SOFTWAREILE P:321 , ASP P:323 , SER P:327BINDING SITE FOR RESIDUE MG P 9275
408WD3SOFTWAREMG P:9269BINDING SITE FOR RESIDUE MG P 9284
409WD4SOFTWAREARG P:398BINDING SITE FOR RESIDUE MG P 9296
410WD5SOFTWAREARG P:396BINDING SITE FOR RESIDUE MG P 9317
411WD6SOFTWAREGLN P:312BINDING SITE FOR RESIDUE MG P 9322
412WD7SOFTWAREVAL P:81BINDING SITE FOR RESIDUE MG P 9326
413WD8SOFTWAREARG P:396BINDING SITE FOR RESIDUE MG P 9329
414WD9SOFTWAREGLU P:179 , ALA P:182 , HOH P:5936BINDING SITE FOR RESIDUE MG P 9333
415XC1SOFTWARETYR D:1205 , VAL D:1221 , ALA D:1225 , HIS D:1367BINDING SITE FOR RESIDUE MG D 9451
416XC2SOFTWAREHOH D:2494BINDING SITE FOR RESIDUE MG D 9452
417XC3SOFTWAREPHE D:1071 , HIS D:1075BINDING SITE FOR RESIDUE MG D 9453
418XC4SOFTWAREHOH D:2735BINDING SITE FOR RESIDUE MG D 9454
419XC5SOFTWAREGLN D:744 , HOH D:2168 , HOH D:2635BINDING SITE FOR RESIDUE MG D 9459
420XC6SOFTWAREGLU D:1179BINDING SITE FOR RESIDUE MG D 9463
421XC7SOFTWAREHOH D:2850BINDING SITE FOR RESIDUE MG D 9517
422XC8SOFTWAREHOH D:9979BINDING SITE FOR RESIDUE MG D 9519
423XC9SOFTWAREASP D:1111BINDING SITE FOR RESIDUE MG D 9520
424XD1SOFTWAREGLU D:1287 , ARG P:172 , HOH P:6306BINDING SITE FOR RESIDUE MG P 9502
425XD2SOFTWAREVAL P:342 , THR P:346BINDING SITE FOR RESIDUE MG P 9536
426XD3SOFTWAREHOH D:2434 , GLU P:111BINDING SITE FOR RESIDUE MG P 9541
427XD4SOFTWAREHOH A:9587 , HOH P:5239BINDING SITE FOR RESIDUE MG P 9558
428YC1SOFTWAREHOH D:2644BINDING SITE FOR RESIDUE MG D 9544
429YC2SOFTWAREGLU D:1284 , THR D:1286BINDING SITE FOR RESIDUE MG D 9561
430YC3SOFTWARELEU E:51 , HOH E:9546 , HOH E:9613BINDING SITE FOR RESIDUE MG E 9115
431YC4SOFTWAREARG E:45 , HOH E:9522BINDING SITE FOR RESIDUE MG E 9131
432YC5SOFTWARETHR E:50BINDING SITE FOR RESIDUE MG E 9184
433YC6SOFTWAREHOH E:9515BINDING SITE FOR RESIDUE MG E 9187
434YC7SOFTWAREHOH E:9604BINDING SITE FOR RESIDUE MG E 9511
435YC8SOFTWARESER F:359 , LYS F:360BINDING SITE FOR RESIDUE MG F 9010
436YC9SOFTWARELEU F:371 , ARG F:372 , HOH F:9662 , HOH F:9761BINDING SITE FOR RESIDUE MG F 9030
437ZC1SOFTWAREASP D:155 , ILE D:565 , MG D:9425 , GLN F:83 , GLU F:87BINDING SITE FOR RESIDUE MG F 9032
438ZC2SOFTWARELYS F:403 , LYS F:407BINDING SITE FOR RESIDUE MG F 9035
439ZC3SOFTWAREGLU F:111 , LYS F:115 , TYR F:173 , MG N:9475BINDING SITE FOR RESIDUE MG F 9045
440ZC4SOFTWAREVAL D:385 , GLU F:97 , VAL F:100 , ARG F:104 , HOH F:9950BINDING SITE FOR RESIDUE MG F 9053
441ZC5SOFTWARELYS F:360 , HOH F:9868BINDING SITE FOR RESIDUE MG F 9054
442ZC6SOFTWAREGLU F:363 , HOH F:9829 , HOH F:9876BINDING SITE FOR RESIDUE MG F 9072
443ZC7SOFTWAREASP F:377BINDING SITE FOR RESIDUE MG F 9089
444ZC8SOFTWARELEU F:147BINDING SITE FOR RESIDUE MG F 9133
445ZC9SOFTWARELYS F:360BINDING SITE FOR RESIDUE MG F 9135

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A68)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Glu A:26 -Pro A:27
2Glu B:26 -Pro B:27
3Leu C:165 -Pro C:166
4Glu K:26 -Pro K:27
5Glu L:26 -Pro L:27
6Leu M:165 -Pro M:166

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A68)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  2C:836-848
M:836-848
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1C:836-848
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1-
M:836-848

(-) Exons   (0, 0)

(no "Exon" information available for 2A68)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THET8 | Q5SHR6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THET8      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68a1 A:1-49,A:173-229 RNA polymerase alpha    d2a68a2 A:50-172 RNA polymerase alpha subunit                                                                              d2a68a1 A:1-49,A:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68A01 A:1-49,A:172-225                         2a68A02 A:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68A01 A:1-49,A:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee.........eeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 A    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain A from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68a1 A:1-49,A:173-229 RNA polymerase alpha    d2a68a2 A:50-172 RNA polymerase alpha subunit                                                                              d2a68a1 A:1-49,A:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68A01 A:1-49,A:172-225                         2a68A02 A:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68A01 A:1-49,A:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee.........eeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 A    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THET8 | Q5SHR6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THET8      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68b1 B:1-49,B:173-229 RNA polymerase alpha    d2a68b2 B:50-172 RNA polymerase alpha subunit                                                                              d2a68b1 B:1-49,B:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68B01 B:1-49,B:172-225                         2a68B02 B:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68B01 B:1-49,B:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 B    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68b1 B:1-49,B:173-229 RNA polymerase alpha    d2a68b2 B:50-172 RNA polymerase alpha subunit                                                                              d2a68b1 B:1-49,B:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68B01 B:1-49,B:172-225                         2a68B02 B:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68B01 B:1-49,B:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 B    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain C from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d2a68c_ C: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains -2a68C012a68C02 C:9-143,C:324-470,C:536-592  [code=3.90.1100.10, no name defined]                                                              2a68C03 C:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             2a68C02 C:9-143,C:324-470,C:536-592  [code=3.90.1100.10, no name defined]                                                                          2a68C04 C:471-535  [code=2.30.150.10, no name defined]           2a68C02 C:9-143,C:324-470,C:536-592                      2a68C05 C:593-667  [code=2.40.50.100, no name defined]                     2a68C01                        2a68C06 C:699-831  [code=2.40.50.150, no name defined]                                                                               2a68C01 C:2-8,C:668-698,C:832-1004  [code=2.40.270.10, no name defined]                                                                                                      ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh...........hhhhhhhhhhh.eee.......eeeee..........hhhhhhhh....eee....eeee......ee.......eee..............eee.eeeee...eeee.........eeee.........eeeeee...eeee.........hhhhhhhh.hhhhhhhhhhh...hhhhhh.hhhhhh.hhhhhhhhhhhh.........hhhhhhh..............hhhhhhh......................hhhhhhhhhhhhhh...............eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhh..eee............hhhhhh.hhhhh.................ee.....ee.....eeeeeee.........eeee..hhhhhh.ee...............eeee....eeee......eee.......hhhhhh..hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh...ee....eeeeee...eeeeee....eeeee....ee.....ee..ee............eeee..............eeee...........eeeeehhhhhh...eeee..eeeeeee.................hhhhh.......................eee......hhhhhhhhhhhhh....eee...........eeeeeeee............eeeeeeeeeeeeee.....eee.....eeeeeeee...............ee..........hhhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeee..ee.................................eeeehhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhh.........hhhhhhhhhhhhhh..ee.................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 C    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain D from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d2a68d_ D: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..hhhhhhhheeee.........................................................hhhhhhheeeeeeeeeeehhhhhh...hhhhhhh....hhhhhhhhhh..eee................eehhhhhhhhhh...ee.......hhhhhhhhhhhh.......ee.......ee....................hhhhhhhhhhhh..............----------------------------------------------------------------------------------------------------------------.............................ee..eee..................................eeeee....eeeee......ee.hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhh.eeeeeee.......eee.....eee.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..................hhhhhhh...hhhhhhhheeee..eeeeeeee.......eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhh.......hhhhhhhhhhhh....eeee.....hhh.eeeeeeeee....eee.hhhhh.........eeeee...hhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh..............hhhhhhhhhhhhhh............hhhhhhhee.hhhhhhhhhhh.........eee....ee..hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............ee...ee........ee.hhhhhhhhhh.......ee....ee........hhhhhhhhhhhhh.....ee.hhhhh......hhhhhh.............hhhhhhhhhhhhhhhh...................hhhhhhhhhh...............eeee......eeeeee....eeeeee.........................hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhhh........eeee...hhhhhhhh..hhhhhhh..hhhhhhhhhhhh.eeee..hhhhhhhh................eeehhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 D    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain E from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d2a68e_ E: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 2a68E00 E:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..hhhhhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhhhh....eee......hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                2a68 E    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain F from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d2a68f3 F:74-257 Sigma70                                                                                                                                                                d2a68f1 F:258-318 Sigma70                                    d2a68f2 F:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2a68F02 F:260-313                                     -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhh...hhhhhhhhhhhhh..ee...........hhhhh.......hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 F   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain K from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THET8 | Q5SHR6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THET8      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68k1 K:1-49,K:173-229 RNA polymerase alpha    d2a68k2 K:50-172 RNA polymerase alpha subunit                                                                              d2a68k1 K:1-49,K:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68K01 K:1-49,K:172-225                         2a68K02 K:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68K01 K:1-49,K:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee.........eeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 K    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain K from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68k1 K:1-49,K:173-229 RNA polymerase alpha    d2a68k2 K:50-172 RNA polymerase alpha subunit                                                                              d2a68k1 K:1-49,K:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68K01 K:1-49,K:172-225                         2a68K02 K:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68K01 K:1-49,K:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee.........eeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 K    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain L from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THET8 | Q5SHR6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THET8      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68l1 L:1-49,L:173-229 RNA polymerase alpha    d2a68l2 L:50-172 RNA polymerase alpha subunit                                                                              d2a68l1 L:1-49,L:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68L01 L:1-49,L:172-225                         2a68L02 L:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68L01 L:1-49,L:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 L    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain L from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d2a68l1 L:1-49,L:173-229 RNA polymerase alpha    d2a68l2 L:50-172 RNA polymerase alpha subunit                                                                              d2a68l1 L:1-49,L:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 2a68L01 L:1-49,L:172-225                         2a68L02 L:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          2a68L01 L:1-49,L:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 L    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain M from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d2a68m_ M: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains -2a68M012a68M02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                              2a68M03 M:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             2a68M02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                                          2a68M04 M:471-535  [code=2.30.150.10, no name defined]           2a68M02 M:9-143,M:324-470,M:536-592                      2a68M05 M:593-667  [code=2.40.50.100, no name defined]                     2a68M01                        2a68M06 M:699-831  [code=2.40.50.150, no name defined]                                                                               2a68M01 M:2-8,M:668-698,M:832-1004  [code=2.40.270.10, no name defined]                                                                                                      ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh...........hhhhhhhhhhh.eee.......eeeee..........hhhhhhhh....eee....eeee......eee......eee..............eee..eee....eeee.........eeee.........eeeeee...eeee.........hhhhhhhh.hhhhhhhhhhh...hhhhhh.hhhhhh..hhhhhhhhhhh.........hhhhhhh..............hhhhhhh......................hhhhhhhhhhhhhh................eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhh..ee.............hhhhhh.hhhhh.................ee.....ee.....eeeeeee.........eeeehhhhhhhh.ee...............eeee....eeee......eee.......hhhhhh..hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh...ee....eeeeee...eeeeee....eeeee....ee.....ee..ee............eeee..............eeee...........eeeeehhhhhh...eeeeeeeeeeeee.................hhhhh.......................eee......hhhhhhhhhhhhh....eee...........eeeeeeee............eeeeeeeeeeeeee.....eee.....eeeeeeee...............ee...........hhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeee..ee.................................eeeehhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhh.........hhhhhhhhhhhhh...eeeee................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 M    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain N from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d2a68n_ N: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..hhhhhhhheeee.........................................................hhhhhhheeeeeeeeeeehhhhhh...hhhhhhh....hhhhhhhhhh...ee..................hhhhhhhhhh...ee.......hhhhhhhhhhhh.......ee.......ee....................hhhhhhhhhhhh..hhhhhh......----------------------------------------------------------------------------------------------------------------.............................ee..eee..................................eeeee....eeeee......ee.hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhh.eeeeeee.......eee.....eee.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..................hhhhhhh...hhhhhhhheeee..eeeeeeee.......eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee.....hhh.eeeeeeeee....eee.hhhhh.........eeeee...hhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh..............hhhhhhhhhhhhhh............hhhhhhhee.hhhhhhhhhhh.........eee....ee..hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh...........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............ee...ee........ee.hhhhhhhhhh.......ee....ee.........hhhhhhhhhhhh.....ee.hhhhh......hhhhhh.............hhhhhhhhhhhhhhhh...................hhhhhhhhhh...............eeee......eeeeee....eeeeee.........................hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.eeeee..........hhhhhhhhhhhhhh........eeee...hhhhhhhh..hhhhhhh..hhhhhhhhhhhh.eeee..hhhhhhhh................eeeehhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 N    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain O from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d2a68o_ O: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 2a68O00 O:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.hhhhhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhhhh...eeee......hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                2a68 O    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain P from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d2a68p3 P:74-257 Sigma70                                                                                                                                                                d2a68p1 P:258-318 Sigma70                                    d2a68p2 P:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2a68P02 P:260-313                                     -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhh...hhhhhhhhhhhhh...............hhhhh.......hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2a68 P   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (8, 20)

Asymmetric Unit

(-) CATH Domains  (10, 24)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A68)

(-) Gene Ontology  (15, 38)

Asymmetric Unit(hide GO term definitions)
Chain A,B,K,L   (RPOA_THET8 | Q5SHR6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain A,B,K,L   (RPOA_THETH | Q9Z9H6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain C,M   (RPOB_THET8 | Q8RQE9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0032549    ribonucleoside binding    Interacting selectively and non-covalently with a ribonucleoside, a compound consisting of a purine or pyrimidine nitrogenous base linked to ribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain D,N   (RPOC_THET8 | Q8RQE8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain E,O   (RPOZ_THET8 | Q8RQE7)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain F,P   (Q5SKW1_THET8 | Q5SKW1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016987    sigma factor activity    A sigma factor is the promoter specificity subunit of eubacterial-type multisubunit RNA polymerases, those whose core subunit composition is often described as alpha(2)-beta-beta-prime. (This type of multisubunit RNA polymerase complex is known to be found in eubacteria and plant plastids). Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, this binds specifically to promoter sequences, with the sigma factor making sequence specific contacts with the promoter elements. The sigma subunit is released from the elongating form of the polymerase and is thus free to act catalytically for multiple RNA polymerase core enzymes.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001123    transcription initiation from bacterial-type RNA polymerase promoter    Any process involved in the assembly of bacterial-type RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RBT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    HD9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    ID1  [ RasMol ]  +environment [ RasMol ]
    ID2  [ RasMol ]  +environment [ RasMol ]
    ID3  [ RasMol ]  +environment [ RasMol ]
    ID4  [ RasMol ]  +environment [ RasMol ]
    ID5  [ RasMol ]  +environment [ RasMol ]
    ID6  [ RasMol ]  +environment [ RasMol ]
    ID7  [ RasMol ]  +environment [ RasMol ]
    ID8  [ RasMol ]  +environment [ RasMol ]
    ID9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    JD1  [ RasMol ]  +environment [ RasMol ]
    JD2  [ RasMol ]  +environment [ RasMol ]
    JD3  [ RasMol ]  +environment [ RasMol ]
    JD4  [ RasMol ]  +environment [ RasMol ]
    JD5  [ RasMol ]  +environment [ RasMol ]
    JD6  [ RasMol ]  +environment [ RasMol ]
    JD7  [ RasMol ]  +environment [ RasMol ]
    JD8  [ RasMol ]  +environment [ RasMol ]
    JD9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    KD1  [ RasMol ]  +environment [ RasMol ]
    KD2  [ RasMol ]  +environment [ RasMol ]
    KD3  [ RasMol ]  +environment [ RasMol ]
    KD4  [ RasMol ]  +environment [ RasMol ]
    KD5  [ RasMol ]  +environment [ RasMol ]
    KD6  [ RasMol ]  +environment [ RasMol ]
    KD7  [ RasMol ]  +environment [ RasMol ]
    KD8  [ RasMol ]  +environment [ RasMol ]
    KD9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    LD1  [ RasMol ]  +environment [ RasMol ]
    LD2  [ RasMol ]  +environment [ RasMol ]
    LD3  [ RasMol ]  +environment [ RasMol ]
    LD4  [ RasMol ]  +environment [ RasMol ]
    LD5  [ RasMol ]  +environment [ RasMol ]
    LD6  [ RasMol ]  +environment [ RasMol ]
    LD7  [ RasMol ]  +environment [ RasMol ]
    LD8  [ RasMol ]  +environment [ RasMol ]
    LD9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    MD1  [ RasMol ]  +environment [ RasMol ]
    MD2  [ RasMol ]  +environment [ RasMol ]
    MD3  [ RasMol ]  +environment [ RasMol ]
    MD4  [ RasMol ]  +environment [ RasMol ]
    MD5  [ RasMol ]  +environment [ RasMol ]
    MD6  [ RasMol ]  +environment [ RasMol ]
    MD7  [ RasMol ]  +environment [ RasMol ]
    MD8  [ RasMol ]  +environment [ RasMol ]
    MD9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    ND1  [ RasMol ]  +environment [ RasMol ]
    ND2  [ RasMol ]  +environment [ RasMol ]
    ND3  [ RasMol ]  +environment [ RasMol ]
    ND4  [ RasMol ]  +environment [ RasMol ]
    ND5  [ RasMol ]  +environment [ RasMol ]
    ND6  [ RasMol ]  +environment [ RasMol ]
    ND7  [ RasMol ]  +environment [ RasMol ]
    ND8  [ RasMol ]  +environment [ RasMol ]
    ND9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    OD1  [ RasMol ]  +environment [ RasMol ]
    OD2  [ RasMol ]  +environment [ RasMol ]
    OD3  [ RasMol ]  +environment [ RasMol ]
    OD4  [ RasMol ]  +environment [ RasMol ]
    OD5  [ RasMol ]  +environment [ RasMol ]
    OD6  [ RasMol ]  +environment [ RasMol ]
    OD7  [ RasMol ]  +environment [ RasMol ]
    OD8  [ RasMol ]  +environment [ RasMol ]
    OD9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    PD1  [ RasMol ]  +environment [ RasMol ]
    PD2  [ RasMol ]  +environment [ RasMol ]
    PD3  [ RasMol ]  +environment [ RasMol ]
    PD4  [ RasMol ]  +environment [ RasMol ]
    PD5  [ RasMol ]  +environment [ RasMol ]
    PD6  [ RasMol ]  +environment [ RasMol ]
    PD7  [ RasMol ]  +environment [ RasMol ]
    PD8  [ RasMol ]  +environment [ RasMol ]
    PD9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    QD1  [ RasMol ]  +environment [ RasMol ]
    QD2  [ RasMol ]  +environment [ RasMol ]
    QD3  [ RasMol ]  +environment [ RasMol ]
    QD4  [ RasMol ]  +environment [ RasMol ]
    QD5  [ RasMol ]  +environment [ RasMol ]
    QD6  [ RasMol ]  +environment [ RasMol ]
    QD7  [ RasMol ]  +environment [ RasMol ]
    QD8  [ RasMol ]  +environment [ RasMol ]
    QD9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    RD1  [ RasMol ]  +environment [ RasMol ]
    RD2  [ RasMol ]  +environment [ RasMol ]
    RD3  [ RasMol ]  +environment [ RasMol ]
    RD4  [ RasMol ]  +environment [ RasMol ]
    RD5  [ RasMol ]  +environment [ RasMol ]
    RD6  [ RasMol ]  +environment [ RasMol ]
    RD7  [ RasMol ]  +environment [ RasMol ]
    RD8  [ RasMol ]  +environment [ RasMol ]
    RD9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    SD1  [ RasMol ]  +environment [ RasMol ]
    SD2  [ RasMol ]  +environment [ RasMol ]
    SD3  [ RasMol ]  +environment [ RasMol ]
    SD4  [ RasMol ]  +environment [ RasMol ]
    SD5  [ RasMol ]  +environment [ RasMol ]
    SD6  [ RasMol ]  +environment [ RasMol ]
    SD7  [ RasMol ]  +environment [ RasMol ]
    SD8  [ RasMol ]  +environment [ RasMol ]
    SD9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    TD1  [ RasMol ]  +environment [ RasMol ]
    TD2  [ RasMol ]  +environment [ RasMol ]
    TD3  [ RasMol ]  +environment [ RasMol ]
    TD4  [ RasMol ]  +environment [ RasMol ]
    TD5  [ RasMol ]  +environment [ RasMol ]
    TD6  [ RasMol ]  +environment [ RasMol ]
    TD7  [ RasMol ]  +environment [ RasMol ]
    TD8  [ RasMol ]  +environment [ RasMol ]
    TD9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    UD1  [ RasMol ]  +environment [ RasMol ]
    UD2  [ RasMol ]  +environment [ RasMol ]
    UD3  [ RasMol ]  +environment [ RasMol ]
    UD4  [ RasMol ]  +environment [ RasMol ]
    UD5  [ RasMol ]  +environment [ RasMol ]
    UD6  [ RasMol ]  +environment [ RasMol ]
    UD7  [ RasMol ]  +environment [ RasMol ]
    UD8  [ RasMol ]  +environment [ RasMol ]
    UD9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    VD1  [ RasMol ]  +environment [ RasMol ]
    VD2  [ RasMol ]  +environment [ RasMol ]
    VD3  [ RasMol ]  +environment [ RasMol ]
    VD4  [ RasMol ]  +environment [ RasMol ]
    VD5  [ RasMol ]  +environment [ RasMol ]
    VD6  [ RasMol ]  +environment [ RasMol ]
    VD7  [ RasMol ]  +environment [ RasMol ]
    VD8  [ RasMol ]  +environment [ RasMol ]
    VD9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    WD1  [ RasMol ]  +environment [ RasMol ]
    WD2  [ RasMol ]  +environment [ RasMol ]
    WD3  [ RasMol ]  +environment [ RasMol ]
    WD4  [ RasMol ]  +environment [ RasMol ]
    WD5  [ RasMol ]  +environment [ RasMol ]
    WD6  [ RasMol ]  +environment [ RasMol ]
    WD7  [ RasMol ]  +environment [ RasMol ]
    WD8  [ RasMol ]  +environment [ RasMol ]
    WD9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    XD1  [ RasMol ]  +environment [ RasMol ]
    XD2  [ RasMol ]  +environment [ RasMol ]
    XD3  [ RasMol ]  +environment [ RasMol ]
    XD4  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:26 - Pro A:27   [ RasMol ]  
    Glu B:26 - Pro B:27   [ RasMol ]  
    Glu K:26 - Pro K:27   [ RasMol ]  
    Glu L:26 - Pro L:27   [ RasMol ]  
    Leu C:165 - Pro C:166   [ RasMol ]  
    Leu M:165 - Pro M:166   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a68
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SKW1_THET8 | Q5SKW1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain Information