Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL BASIS FOR TRANSCRIPTION REGULATION BY ALARMONE PPGPP
 
Authors :  I. Artsimovitch, V. Patlan, S. Sekine, M. N. Vassylyeva, T. Hosaka, K. Ochi, S. Yokoyama, D. G. Vassylyev, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  10 Mar 04  (Deposition) - 18 May 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F,K,L,M,N,O,P
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  K,L,M,N,O,P  (1x)
Keywords :  Rna Polymerase Holoenzyme, Guanosine-Tetraphosphate, Ppgpp, Transcription Regulation, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Artsimovitch, V. Patlan, S. Sekine, M. N. Vassylyeva, T. Hosaka, K. Ochi, S. Yokoyama, D. G. Vassylyev
Structural Basis For Transcription Regulation By Alarmone Ppgpp
Cell(Cambridge, Mass. ) V. 117 299 2004
PubMed-ID: 15109491  |  Reference-DOI: 10.1016/S0092-8674(04)00401-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
    ChainsA, B, K, L
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP ALPHA SUBUNIT, TRANSCRIPTASE ALPHA CHAIN, RNA POLYMERASE ALPHA SUBUNIT
 
Molecule 2 - DNA-DIRECTED RNA POLYMERASE BETA CHAIN
    ChainsC, M
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP BETA SUBUNIT, TRANSCRIPTASE BETA CHAIN, RNA POLYMERASE BETA SUBUNIT
 
Molecule 3 - DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    ChainsD, N
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymRNAP BETA' SUBUNIT, TRANSCRIPTASE BETA' CHAIN, RNA POLYMERASE BETA' SUBUNIT
 
Molecule 4 - RNA POLYMERASE OMEGA SUBUNIT
    ChainsE, O
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 5 - PRINCIPAL SIGMA FACTOR
    ChainsF, P
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFKLMNOP
Biological Unit 1 (1x)ABCDEF      
Biological Unit 2 (1x)      KLMNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 368)

Asymmetric Unit (3, 368)
No.NameCountTypeFull Name
1G4P2Ligand/IonGUANOSINE-5',3'-TETRAPHOSPHATE
2MG362Ligand/IonMAGNESIUM ION
3ZN4Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1G4P-1Ligand/IonGUANOSINE-5',3'-TETRAPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1G4P2Ligand/IonGUANOSINE-5',3'-TETRAPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
3ZN-1Ligand/IonZINC ION

(-) Sites  (354, 354)

Asymmetric Unit (354, 354)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREALA A:52 , LYS A:83 , LEU A:85 , VAL A:170 , HOH A:9623BINDING SITE FOR RESIDUE MG A 9209
002AC2SOFTWARELYS A:159 , ASP A:160 , ARG A:161 , ILE A:162 , HOH A:9777BINDING SITE FOR RESIDUE MG A 9212
003AC3SOFTWAREASP A:74 , PHE C:628 , HOH C:2048 , HOH C:9863BINDING SITE FOR RESIDUE MG A 9224
004AC4SOFTWAREARG A:88 , GLU A:121 , ILE A:122 , MET A:123BINDING SITE FOR RESIDUE MG A 9227
005AC5SOFTWAREASN A:212BINDING SITE FOR RESIDUE MG A 9254
006AC6SOFTWAREMG A:9437 , HOH A:9637 , HOH A:9749BINDING SITE FOR RESIDUE MG A 9268
007AC7SOFTWAREGLU A:59 , ASN A:139 , HOH A:9627 , HOH A:9651 , HOH A:9801BINDING SITE FOR RESIDUE MG A 9273
008AC8SOFTWARELYS A:107 , ASP A:113BINDING SITE FOR RESIDUE MG A 9295
009AC9SOFTWARETRP A:200 , MG A:9464BINDING SITE FOR RESIDUE MG A 9327
010AD1SOFTWAREGLU D:1152 , ARG D:1159 , HOH D:9677BINDING SITE FOR RESIDUE MG D 9417
011AD2SOFTWAREASP D:107 , ARG D:586 , THR D:1444BINDING SITE FOR RESIDUE MG D 9419
012AD3SOFTWAREHOH D:2941 , HOH D:3121BINDING SITE FOR RESIDUE MG D 9421
013AD4SOFTWARELYS D:165 , HOH D:2251 , HOH D:9939BINDING SITE FOR RESIDUE MG D 9428
014AD5SOFTWARETHR D:808 , HOH D:3016BINDING SITE FOR RESIDUE MG D 9434
015AD6SOFTWARELYS D:7BINDING SITE FOR RESIDUE MG D 9435
016AD7SOFTWAREHOH D:2207 , HOH D:2209 , MG D:9390BINDING SITE FOR RESIDUE MG D 9439
017AD8SOFTWAREHOH D:2305 , HOH D:2368 , HOH D:9578BINDING SITE FOR RESIDUE MG D 9440
018AD9SOFTWAREASP D:1090 , TYR D:1093 , HOH D:2364 , HOH D:2905BINDING SITE FOR RESIDUE MG D 9443
019BC1SOFTWAREHOH A:9688 , LYS P:154 , GLU P:158 , GLN P:161BINDING SITE FOR RESIDUE MG A 9329
020BC2SOFTWARESER A:93 , HOH A:9725BINDING SITE FOR RESIDUE MG A 9334
021BC3SOFTWAREARG A:175 , ASP A:202 , HOH A:9659BINDING SITE FOR RESIDUE MG A 9365
022BC4SOFTWAREGLN A:188 , ARG A:189 , LEU A:192BINDING SITE FOR RESIDUE MG A 9368
023BC5SOFTWAREMG A:9486 , HOH A:9729BINDING SITE FOR RESIDUE MG A 9394
024BC6SOFTWAREASN A:91 , SER A:93 , HOH A:9636 , HOH A:9833BINDING SITE FOR RESIDUE MG A 9423
025BC7SOFTWAREMG A:9268BINDING SITE FOR RESIDUE MG A 9437
026BC8SOFTWAREARG A:18 , ARG A:88 , LEU A:90 , GLU A:121 , HOH A:9556BINDING SITE FOR RESIDUE MG A 9442
027BC9SOFTWAREASP A:191 , LYS C:938BINDING SITE FOR RESIDUE MG A 9462
028BD1SOFTWAREHOH D:2238 , HOH D:2836 , HOH D:9798BINDING SITE FOR RESIDUE MG D 9447
029BD2SOFTWAREGLN D:636 , LYS D:638BINDING SITE FOR RESIDUE MG D 9448
030BD3SOFTWAREHOH D:2295BINDING SITE FOR RESIDUE MG D 9452
031BD4SOFTWARELYS D:960 , ARG D:1058 , SER D:1059 , SER D:1060 , HOH D:2237 , MG D:9233 , MG D:9380 , HOH D:9638BINDING SITE FOR RESIDUE MG D 9455
032BD5SOFTWAREPHE C:425 , ARG C:428 , HOH C:2470 , ALA D:1082 , LEU D:1086BINDING SITE FOR RESIDUE MG D 9456
033BD6SOFTWARETYR D:868 , MET D:869BINDING SITE FOR RESIDUE MG D 9460
034BD7SOFTWAREVAL D:1503BINDING SITE FOR RESIDUE MG D 9461
035BD8SOFTWARELYS D:62 , TYR D:63 , GLU D:74 , HOH D:2359 , HOH D:2689BINDING SITE FOR RESIDUE MG D 9467
036BD9SOFTWAREHOH D:2109BINDING SITE FOR RESIDUE MG D 9469
037CC1SOFTWAREARG A:176 , MG A:9327BINDING SITE FOR RESIDUE MG A 9464
038CC2SOFTWAREGLU A:133 , HOH A:9571 , VAL C:645BINDING SITE FOR RESIDUE MG A 9473
039CC3SOFTWAREGLU A:134 , MG A:9394 , LYS C:605BINDING SITE FOR RESIDUE MG A 9486
040CC4SOFTWAREHOH A:9695 , HOH A:9808BINDING SITE FOR RESIDUE MG A 9517
041CC5SOFTWARELYS A:159BINDING SITE FOR RESIDUE MG A 9520
042CC6SOFTWAREPRO A:106BINDING SITE FOR RESIDUE MG A 9521
043CC7SOFTWAREASN A:91 , HOH A:9734 , HOH A:9791BINDING SITE FOR RESIDUE MG A 9543
044CC8SOFTWAREHOH B:9722BINDING SITE FOR RESIDUE MG A 9544
045CC9SOFTWARETYR A:224 , HOH A:9644 , HOH A:9771BINDING SITE FOR RESIDUE MG A 9555
046CD1SOFTWAREHOH D:2634 , HOH D:2978 , MG D:9379BINDING SITE FOR RESIDUE MG D 9470
047CD2SOFTWAREGLU D:998 , HOH D:2957 , HOH D:9679 , HOH P:8016BINDING SITE FOR RESIDUE MG D 9472
048CD3SOFTWAREHOH D:2776 , HOH D:2905BINDING SITE FOR RESIDUE MG D 9475
049CD4SOFTWAREHOH D:3092 , HOH D:9976 , HOH E:9676BINDING SITE FOR RESIDUE MG D 9477
050CD5SOFTWAREHOH D:2292 , HOH D:2492 , MG D:9342BINDING SITE FOR RESIDUE MG D 9478
051CD6SOFTWAREHOH F:2081BINDING SITE FOR RESIDUE MG D 9479
052CD7SOFTWAREARG D:1087 , HOH D:9624BINDING SITE FOR RESIDUE MG D 9480
053CD8SOFTWAREASP D:55 , TYR D:56 , LYS D:82BINDING SITE FOR RESIDUE MG D 9481
054CD9SOFTWAREGLU D:1161 , HOH D:9751BINDING SITE FOR RESIDUE MG D 9482
055DC1SOFTWAREPHE B:65 , SER B:66 , THR B:67 , ASP B:74BINDING SITE FOR RESIDUE MG B 9228
056DC2SOFTWAREVAL A:13 , HOH A:9718 , GLN B:229 , HOH D:2139BINDING SITE FOR RESIDUE MG B 9230
057DC3SOFTWAREGLU B:73 , GLU B:77 , ILE B:78 , HOH B:9632 , HOH B:9639BINDING SITE FOR RESIDUE MG B 9235
058DC4SOFTWAREARG B:146 , HOH B:9605BINDING SITE FOR RESIDUE MG B 9256
059DC5SOFTWAREPHE B:23 , THR B:196 , LEU B:197 , ARG B:198BINDING SITE FOR RESIDUE MG B 9260
060DC6SOFTWAREHIS B:63 , PHE B:65 , SER B:66BINDING SITE FOR RESIDUE MG B 9280
061DC7SOFTWAREGLN B:188 , ASP D:685 , HOH D:2171 , HOH D:2358BINDING SITE FOR RESIDUE MG B 9281
062DC8SOFTWAREPRO B:152 , ILE D:857 , HOH D:2279BINDING SITE FOR RESIDUE MG B 9306
063DC9SOFTWARESER B:93 , LEU B:94 , ASP B:119 , HOH B:9651BINDING SITE FOR RESIDUE MG B 9311
064DD1SOFTWAREGLU D:69 , GLY D:70 , LYS D:71 , HOH D:2832BINDING SITE FOR RESIDUE MG D 9490
065DD2SOFTWAREHOH D:3228BINDING SITE FOR RESIDUE MG D 9492
066DD3SOFTWAREARG D:1213 , MG D:9258BINDING SITE FOR RESIDUE MG D 9498
067DD4SOFTWAREGLU D:891 , MG D:9384BINDING SITE FOR RESIDUE MG D 9499
068DD5SOFTWAREARG D:921BINDING SITE FOR RESIDUE MG D 9502
069DD6SOFTWAREHOH D:2122 , HOH D:2897BINDING SITE FOR RESIDUE MG D 9503
070DD7SOFTWAREHOH D:2275 , MG D:9533BINDING SITE FOR RESIDUE MG D 9505
071DD8SOFTWAREHOH D:2890BINDING SITE FOR RESIDUE MG D 9506
072DD9SOFTWARELEU N:227 , HOH N:2644 , HOH P:1787BINDING SITE FOR RESIDUE MG D 9510
073EC1SOFTWAREGLN B:180 , GLU B:182 , MG B:9491 , HOH B:9576BINDING SITE FOR RESIDUE MG B 9412
074EC2SOFTWAREGLN B:95 , ASP B:145 , ARG B:146 , HOH B:9657BINDING SITE FOR RESIDUE MG B 9413
075EC3SOFTWAREHOH A:9588 , ARG B:189BINDING SITE FOR RESIDUE MG B 9420
076EC4SOFTWAREARG B:219BINDING SITE FOR RESIDUE MG B 9426
077EC5SOFTWAREGLU B:29 , ARG B:30 , ASP B:191 , LEU B:192 , ASP B:193 , HOH B:9697BINDING SITE FOR RESIDUE MG B 9427
078EC6SOFTWAREHOH B:9644 , HOH B:9704 , HOH B:9723BINDING SITE FOR RESIDUE MG B 9446
079EC7SOFTWAREVAL B:71 , LYS B:72BINDING SITE FOR RESIDUE MG B 9458
080EC8SOFTWARETHR B:206 , LEU B:208 , MG B:9552 , HOH B:9561 , HOH B:9668 , HOH B:9691BINDING SITE FOR RESIDUE MG B 9485
081EC9SOFTWAREMG B:9560BINDING SITE FOR RESIDUE MG B 9488
082ED1SOFTWAREALA D:1502 , MG D:9529 , HOH E:9640BINDING SITE FOR RESIDUE MG D 9512
083ED2SOFTWAREMG D:9392BINDING SITE FOR RESIDUE MG D 9515
084ED3SOFTWAREALA D:100 , MET D:512 , ILE D:513 , HOH D:9584BINDING SITE FOR RESIDUE MG D 9523
085ED4SOFTWAREARG B:185 , HOH B:9611 , HOH B:9613 , LYS D:646 , TRP D:688 , HOH D:2534BINDING SITE FOR RESIDUE MG D 9527
086ED5SOFTWAREHOH B:9604 , GLU D:888BINDING SITE FOR RESIDUE MG D 9528
087ED6SOFTWAREMG D:9512 , HOH E:9640BINDING SITE FOR RESIDUE MG D 9529
088ED7SOFTWARELEU D:823 , HOH D:2121 , HOH D:2487BINDING SITE FOR RESIDUE MG D 9532
089ED8SOFTWAREHOH C:9892 , ASP D:682 , MG D:9505BINDING SITE FOR RESIDUE MG D 9533
090ED9SOFTWAREASN D:143 , HOH D:2681 , HOH D:3065 , HOH D:3179 , MG D:9325BINDING SITE FOR RESIDUE MG D 9535
091FC1SOFTWAREGLU B:182 , MG B:9412BINDING SITE FOR RESIDUE MG B 9491
092FC2SOFTWAREHOH B:9635 , HOH B:9758BINDING SITE FOR RESIDUE MG B 9541
093FC3SOFTWARETHR B:15 , LEU B:208 , MG B:9485BINDING SITE FOR RESIDUE MG B 9552
094FC4SOFTWAREMG B:9488BINDING SITE FOR RESIDUE MG B 9560
095FC5SOFTWAREGLU C:685 , HOH D:9563 , G4P N:9100 , HOH N:9208 , HOH N:9209BINDING SITE FOR RESIDUE MG C 9202
096FC6SOFTWAREASP C:686 , ALA C:687 , ILE C:688 , ASN C:845 , GLY C:847BINDING SITE FOR RESIDUE MG C 9210
097FC7SOFTWAREVAL C:461 , ASP C:462 , GLU C:463 , LEU C:464 , GLY C:465 , PHE C:466BINDING SITE FOR RESIDUE MG C 9213
098FC8SOFTWAREG4P N:9100 , HOH N:9210BINDING SITE FOR RESIDUE MG C 9217
099FC9SOFTWAREARG C:292 , LYS C:299BINDING SITE FOR RESIDUE MG C 9219
100FD1SOFTWAREHOH L:1491BINDING SITE FOR RESIDUE MG D 9536
101FD2SOFTWARETYR D:63 , VAL D:72 , HOH D:3032BINDING SITE FOR RESIDUE MG D 9539
102FD3SOFTWAREILE D:32 , MET D:527 , MG D:9261BINDING SITE FOR RESIDUE MG D 9546
103FD4SOFTWAREHOH D:3247BINDING SITE FOR RESIDUE MG D 9547
104FD5SOFTWAREHOH N:9528BINDING SITE FOR RESIDUE MG D 9548
105FD6SOFTWAREGLU D:219 , ARG D:220 , ALA D:221 , HOH D:2084 , HOH D:9564BINDING SITE FOR RESIDUE MG D 9557
106FD7SOFTWARETRP D:897 , LEU D:902BINDING SITE FOR RESIDUE MG D 9559
107FD8SOFTWARETHR E:50 , MG E:9484BINDING SITE FOR RESIDUE MG E 9249
108FD9SOFTWARELYS E:87BINDING SITE FOR RESIDUE MG E 9275
109GC1SOFTWAREPHE C:679 , ASP C:680 , GLY C:681 , TYR C:682 , ASN C:683BINDING SITE FOR RESIDUE MG C 9221
110GC2SOFTWARELYS C:518 , GLY C:519 , HOH C:9564 , HOH C:9953BINDING SITE FOR RESIDUE MG C 9222
111GC3SOFTWAREARG C:353 , GLY C:354 , GLU C:357BINDING SITE FOR RESIDUE MG C 9223
112GC4SOFTWAREARG C:586 , ASP C:590 , MG C:9255 , HOH C:9871BINDING SITE FOR RESIDUE MG C 9231
113GC5SOFTWAREPRO C:1012 , LEU C:1021 , GLY C:1022 , GLY C:1023 , GLN C:1026 , HOH C:9843BINDING SITE FOR RESIDUE MG C 9238
114GC6SOFTWAREVAL C:943 , VAL C:973 , LEU C:974 , PRO C:982 , ILE C:983BINDING SITE FOR RESIDUE MG C 9239
115GC7SOFTWAREHIS C:434 , TYR C:435 , GLY C:436 , ARG C:437 , ILE C:438BINDING SITE FOR RESIDUE MG C 9243
116GC8SOFTWAREARG C:586 , HOH C:2096 , MG C:9231BINDING SITE FOR RESIDUE MG C 9255
117GC9SOFTWAREGLN C:1019 , ARG C:1031 , HOH C:2055 , GLN D:616 , MG F:9244BINDING SITE FOR RESIDUE MG C 9257
118GD1SOFTWAREPRO E:81 , HOH E:9619BINDING SITE FOR RESIDUE MG E 9288
119GD2SOFTWARETHR E:70 , GLY E:71 , ARG E:72 , LEU E:73BINDING SITE FOR RESIDUE MG E 9341
120GD3SOFTWAREARG D:760 , GLU E:3 , PRO E:4 , MET E:65BINDING SITE FOR RESIDUE MG E 9352
121GD4SOFTWAREHOH D:9644 , ARG E:84 , GLU E:88 , ARG E:91 , HOH E:9574BINDING SITE FOR RESIDUE MG E 9366
122GD5SOFTWAREGLU E:90 , GLU E:96BINDING SITE FOR RESIDUE MG E 9373
123GD6SOFTWAREHOH D:2117 , LYS E:25 , HOH E:9692BINDING SITE FOR RESIDUE MG E 9389
124GD7SOFTWAREMET E:12 , HOH E:9661 , HOH E:9710BINDING SITE FOR RESIDUE MG E 9431
125GD8SOFTWARELYS D:1490 , ASN E:37 , THR E:38 , TYR E:93 , HOH E:9650BINDING SITE FOR RESIDUE MG E 9432
126GD9SOFTWAREHOH D:3137 , MG E:9484BINDING SITE FOR RESIDUE MG E 9449
127HC1SOFTWAREMG C:9519 , HIS P:263 , GLU P:266BINDING SITE FOR RESIDUE MG C 9259
128HC2SOFTWAREALA C:574 , GLN C:575 , GLU C:662 , MG C:9316BINDING SITE FOR RESIDUE MG C 9263
129HC3SOFTWARETHR C:888 , HIS C:889 , GLY C:970 , VAL C:988 , VAL C:989BINDING SITE FOR RESIDUE MG C 9264
130HC4SOFTWAREPHE C:684 , ASN C:872 , LEU C:874 , HOH C:2136 , ASP D:784BINDING SITE FOR RESIDUE MG C 9266
131HC5SOFTWAREGLY C:416 , ARG C:420 , HOH C:9952BINDING SITE FOR RESIDUE MG C 9267
132HC6SOFTWAREPHE C:1032 , MET C:1052 , HIS D:748BINDING SITE FOR RESIDUE MG C 9272
133HC7SOFTWAREPRO C:144 , LEU C:165 , ARG C:265 , ARG C:266 , HOH C:9649BINDING SITE FOR RESIDUE MG C 9282
134HC8SOFTWAREPRO C:150 , ASP C:151 , PRO C:152BINDING SITE FOR RESIDUE MG C 9284
135HC9SOFTWAREALA C:1065 , GLU C:1068 , ALA C:1069 , GLU C:1074 , PRO C:1077BINDING SITE FOR RESIDUE MG C 9287
136HD1SOFTWAREHOH E:9557BINDING SITE FOR RESIDUE MG E 9457
137HD2SOFTWAREHOH D:3137 , MG E:9249 , MG E:9449BINDING SITE FOR RESIDUE MG E 9484
138HD3SOFTWAREGLU E:52 , HOH E:9667BINDING SITE FOR RESIDUE MG E 9494
139HD4SOFTWAREHOH E:9631BINDING SITE FOR RESIDUE MG E 9551
140HD5SOFTWAREARG F:184 , ILE F:188BINDING SITE FOR RESIDUE MG F 9229
141HD6SOFTWAREMG C:9257 , GLN D:616 , HOH D:2635 , PHE F:328 , HOH F:9925BINDING SITE FOR RESIDUE MG F 9244
142HD7SOFTWAREPRO F:334 , GLU F:336 , HOH F:9836BINDING SITE FOR RESIDUE MG F 9245
143HD8SOFTWAREPHE F:389 , PHE F:390 , MG F:9407 , HOH F:9599BINDING SITE FOR RESIDUE MG F 9250
144HD9SOFTWAREPHE C:778 , LYS F:409 , GLU F:412 , SER F:413 , ARG F:416 , HOH F:9600 , HOH F:9720BINDING SITE FOR RESIDUE MG F 9251
145IC1SOFTWAREHOH C:2083BINDING SITE FOR RESIDUE MG C 9289
146IC2SOFTWAREGLN C:1050 , HOH D:2380BINDING SITE FOR RESIDUE MG C 9292
147IC3SOFTWARETYR C:494BINDING SITE FOR RESIDUE MG C 9293
148IC4SOFTWAREARG C:353 , MG C:9397BINDING SITE FOR RESIDUE MG C 9299
149IC5SOFTWAREGLY C:7 , ASP C:907 , GLY C:908 , LYS C:910BINDING SITE FOR RESIDUE MG C 9300
150IC6SOFTWAREGLU C:232 , HOH C:2727BINDING SITE FOR RESIDUE MG C 9313
151IC7SOFTWAREALA C:574 , ARG C:642 , SER C:661 , GLU C:662 , HOH C:2028 , MG C:9263BINDING SITE FOR RESIDUE MG C 9316
152IC8SOFTWAREGLN C:834 , HOH C:2073BINDING SITE FOR RESIDUE MG C 9320
153IC9SOFTWARESER C:366 , LYS C:371BINDING SITE FOR RESIDUE MG C 9321
154ID1SOFTWAREARG F:372 , LYS F:373 , GLY F:378 , HOH F:2056 , HOH F:9666BINDING SITE FOR RESIDUE MG F 9270
155ID2SOFTWAREARG F:142 , GLY F:146 , HOH F:9740BINDING SITE FOR RESIDUE MG F 9278
156ID3SOFTWAREHOH F:2171 , ARG K:185 , HOH K:2002BINDING SITE FOR RESIDUE MG F 9290
157ID4SOFTWAREASN D:569 , HOH D:2196 , PRO F:80 , VAL F:81 , TYR F:84BINDING SITE FOR RESIDUE MG F 9297
158ID5SOFTWAREARG F:132 , GLU F:181 , ARG F:184BINDING SITE FOR RESIDUE MG F 9298
159ID6SOFTWARELYS D:131 , ARG D:572 , HOH D:9825 , ASP F:79 , GLN F:83BINDING SITE FOR RESIDUE MG F 9302
160ID7SOFTWAREPRO F:286 , THR F:287 , GLU F:290 , ILE F:291BINDING SITE FOR RESIDUE MG F 9303
161ID8SOFTWAREGLY F:322 , ASP F:323 , HOH F:9633 , HOH F:9696BINDING SITE FOR RESIDUE MG F 9305
162ID9SOFTWAREHOH F:9884BINDING SITE FOR RESIDUE MG F 9309
163JC1SOFTWARELYS C:1105 , HOH C:2201BINDING SITE FOR RESIDUE MG C 9328
164JC2SOFTWAREHOH C:2751BINDING SITE FOR RESIDUE MG C 9330
165JC3SOFTWAREASP C:81 , TYR C:629BINDING SITE FOR RESIDUE MG C 9335
166JC4SOFTWARELYS C:61 , MET C:359 , HOH C:2063 , HOH C:9985BINDING SITE FOR RESIDUE MG C 9338
167JC5SOFTWAREPRO C:1012 , PRO F:334BINDING SITE FOR RESIDUE MG C 9339
168JC6SOFTWAREARG C:8 , ARG C:10 , HOH C:2553 , MG C:9534 , HOH C:9878BINDING SITE FOR RESIDUE MG C 9345
169JC7SOFTWAREGLY C:477 , ILE C:508 , PRO C:526 , HOH C:2832 , MG C:9378 , ARG N:35BINDING SITE FOR RESIDUE MG C 9346
170JC8SOFTWAREARG C:292 , ASP C:295 , GLU C:297BINDING SITE FOR RESIDUE MG C 9347
171JC9SOFTWAREGLU C:709 , VAL C:822 , ARG C:824BINDING SITE FOR RESIDUE MG C 9348
172JD1SOFTWAREHOH D:2183 , LEU F:349 , LEU F:350 , LEU F:422BINDING SITE FOR RESIDUE MG F 9310
173JD2SOFTWAREGLU F:158 , LYS F:162 , HOH F:9697 , HOH K:4193BINDING SITE FOR RESIDUE MG F 9323
174JD3SOFTWAREGLY M:316 , VAL M:317 , HOH M:2371BINDING SITE FOR RESIDUE MG F 9324
175JD4SOFTWARETHR F:203 , GLY F:204BINDING SITE FOR RESIDUE MG F 9326
176JD5SOFTWAREHOH F:9839 , HOH K:6577BINDING SITE FOR RESIDUE MG F 9340
177JD6SOFTWARELEU F:271 , THR F:307 , LEU F:308BINDING SITE FOR RESIDUE MG F 9374
178JD7SOFTWAREGLU F:189BINDING SITE FOR RESIDUE MG F 9375
179JD8SOFTWAREGLU F:384 , GLY F:387 , HOH F:2142 , HOH F:9764 , HOH F:9813BINDING SITE FOR RESIDUE MG F 9382
180JD9SOFTWAREHOH F:9779BINDING SITE FOR RESIDUE MG F 9388
181KC1SOFTWAREGLU C:301BINDING SITE FOR RESIDUE MG C 9354
182KC2SOFTWAREASP C:396 , HOH C:9619BINDING SITE FOR RESIDUE MG C 9356
183KC3SOFTWAREHOH C:2445 , HOH C:9764BINDING SITE FOR RESIDUE MG C 9358
184KC4SOFTWAREARG C:168 , HOH C:2130 , HOH C:2484BINDING SITE FOR RESIDUE MG C 9359
185KC5SOFTWAREGLU C:913 , HOH C:2044 , HOH C:2278 , MG C:9454 , HOH C:9962BINDING SITE FOR RESIDUE MG C 9364
186KC6SOFTWAREASN C:330 , HOH C:2160 , MG C:9509 , HOH C:9923BINDING SITE FOR RESIDUE MG C 9367
187KC7SOFTWAREHIS C:1006 , ARG D:628BINDING SITE FOR RESIDUE MG C 9371
188KC8SOFTWAREGLY C:477 , HOH C:2832 , MG C:9346 , HOH C:9591 , ARG N:35BINDING SITE FOR RESIDUE MG C 9378
189KC9SOFTWAREGLU C:527 , HOH C:2619 , HOH P:4201BINDING SITE FOR RESIDUE MG C 9381
190KD1SOFTWAREARG F:249BINDING SITE FOR RESIDUE MG F 9398
191KD2SOFTWAREVAL F:386 , GLY F:387 , PHE F:389 , PHE F:390 , MG F:9250 , HOH F:9617BINDING SITE FOR RESIDUE MG F 9407
192KD3SOFTWARESER F:362 , ILE F:400 , MG F:9463 , HOH F:9901BINDING SITE FOR RESIDUE MG F 9414
193KD4SOFTWAREHOH F:9733 , HOH F:9804 , HOH F:9843BINDING SITE FOR RESIDUE MG F 9424
194KD5SOFTWARETYR F:329BINDING SITE FOR RESIDUE MG F 9425
195KD6SOFTWAREHOH F:9755 , HOH F:9762 , HOH F:9781 , HOH F:9877BINDING SITE FOR RESIDUE MG F 9436
196KD7SOFTWAREGLU F:324 , LYS F:325BINDING SITE FOR RESIDUE MG F 9445
197KD8SOFTWAREHOH F:9820 , HOH N:9254 , HOH N:9731 , HOH N:9882BINDING SITE FOR RESIDUE MG F 9450
198KD9SOFTWAREHOH C:2517 , HOH F:9729 , HOH F:9930BINDING SITE FOR RESIDUE MG F 9453
199LC1SOFTWARELEU C:200 , PHE C:298 , LYS C:299 , ASP C:300BINDING SITE FOR RESIDUE MG C 9383
200LC2SOFTWARELEU C:66 , VAL C:355 , LEU C:372 , HOH C:2671 , HOH C:2843BINDING SITE FOR RESIDUE MG C 9385
201LC3SOFTWARELYS C:167 , ARG C:168BINDING SITE FOR RESIDUE MG C 9387
202LC4SOFTWAREGLU C:20 , ARG C:28BINDING SITE FOR RESIDUE MG C 9395
203LC5SOFTWAREASN C:374 , SER C:375 , PRO C:377 , LEU C:378BINDING SITE FOR RESIDUE MG C 9396
204LC6SOFTWAREVAL C:346 , ARG C:353 , MG C:9299BINDING SITE FOR RESIDUE MG C 9397
205LC7SOFTWAREHOH C:2204 , HOH C:2632BINDING SITE FOR RESIDUE MG C 9405
206LC8SOFTWAREGLU C:551 , PHE C:906 , ASP C:907 , GLY C:908BINDING SITE FOR RESIDUE MG C 9408
207LC9SOFTWAREHOH C:2775 , MG C:9519 , HIS P:263BINDING SITE FOR RESIDUE MG C 9411
208LD1SOFTWARESER F:362 , MG F:9414BINDING SITE FOR RESIDUE MG F 9463
209LD2SOFTWAREHOH F:9683BINDING SITE FOR RESIDUE MG F 9468
210LD3SOFTWAREHOH F:9754 , HOH F:9870BINDING SITE FOR RESIDUE MG F 9471
211LD4SOFTWAREGLY F:391 , VAL F:392 , HOH F:9894BINDING SITE FOR RESIDUE MG F 9483
212LD5SOFTWAREHOH F:2172 , HOH F:9907 , HOH F:9977BINDING SITE FOR RESIDUE MG F 9495
213LD6SOFTWAREHOH D:3277 , HIS F:143 , ILE F:144 , HOH F:9613BINDING SITE FOR RESIDUE MG F 9496
214LD7SOFTWARELYS F:230 , ARG F:231 , HOH F:9746BINDING SITE FOR RESIDUE MG F 9500
215LD8SOFTWAREHOH D:9788 , GLU F:318BINDING SITE FOR RESIDUE MG F 9508
216LD9SOFTWAREARG D:674 , VAL F:342BINDING SITE FOR RESIDUE MG F 9513
217MC1SOFTWARETHR C:480BINDING SITE FOR RESIDUE MG C 9418
218MC2SOFTWARELYS C:915 , LEU C:968 , GLN C:969 , HOH C:2856 , ASP D:952BINDING SITE FOR RESIDUE MG C 9422
219MC3SOFTWAREGLU C:764 , SER C:765BINDING SITE FOR RESIDUE MG C 9429
220MC4SOFTWAREPRO C:79 , GLN C:80 , ASP C:81 , MG C:9497BINDING SITE FOR RESIDUE MG C 9430
221MC5SOFTWAREARG A:41 , GLU C:856 , MET C:858 , HIS C:860 , GLY C:977BINDING SITE FOR RESIDUE MG C 9438
222MC6SOFTWAREGLN C:567 , LYS C:846BINDING SITE FOR RESIDUE MG C 9441
223MC7SOFTWAREHOH C:2395 , HOH C:2624BINDING SITE FOR RESIDUE MG C 9444
224MC8SOFTWAREARG C:142 , SER C:161BINDING SITE FOR RESIDUE MG C 9451
225MC9SOFTWAREGLU C:913 , HOH C:2218 , MG C:9364BINDING SITE FOR RESIDUE MG C 9454
226MD1SOFTWAREARG F:284BINDING SITE FOR RESIDUE MG F 9516
227MD2SOFTWAREHOH F:9895 , HOH N:2016 , HOH N:9731BINDING SITE FOR RESIDUE MG F 9531
228MD3SOFTWAREHOH F:9971BINDING SITE FOR RESIDUE MG F 9537
229MD4SOFTWAREHOH F:2155 , HOH F:9911BINDING SITE FOR RESIDUE MG F 9540
230MD5SOFTWARELYS F:407 , HOH F:2016 , HOH F:9843BINDING SITE FOR RESIDUE MG F 9558
231MD6SOFTWAREGLU M:685 , ASP N:739 , G4P N:9101 , HOH N:9213 , HOH N:9214BINDING SITE FOR RESIDUE MG M 9206
232MD7SOFTWARECYS N:58 , CYS N:60 , CYS N:73 , CYS N:76BINDING SITE FOR RESIDUE ZN N 9104
233MD8SOFTWARECYS N:1112 , CYS N:1194 , CYS N:1201 , CYS N:1204 , HOH N:9487BINDING SITE FOR RESIDUE ZN N 9105
234MD9SOFTWAREASP N:739 , ASP N:741 , ASP N:743 , HOH N:9555BINDING SITE FOR RESIDUE MG N 9205
235NC1SOFTWARESER C:1117 , LYS C:1118 , HOH D:2175BINDING SITE FOR RESIDUE MG C 9459
236NC2SOFTWAREGLU C:1113BINDING SITE FOR RESIDUE MG C 9465
237NC3SOFTWAREASP C:653 , HOH C:2211 , HOH C:9669BINDING SITE FOR RESIDUE MG C 9466
238NC4SOFTWAREGLU C:622 , PRO C:624 , MG C:9476BINDING SITE FOR RESIDUE MG C 9474
239NC5SOFTWAREMG C:9474BINDING SITE FOR RESIDUE MG C 9476
240NC6SOFTWAREPRO C:244BINDING SITE FOR RESIDUE MG C 9489
241NC7SOFTWAREHOH C:9616BINDING SITE FOR RESIDUE MG C 9493
242NC8SOFTWAREASP C:81 , MG C:9430BINDING SITE FOR RESIDUE MG C 9497
243NC9SOFTWAREASP C:554 , ASN C:556 , ARG D:1042 , HOH D:9673BINDING SITE FOR RESIDUE MG C 9501
244ND1SOFTWAREARG N:783 , HOH N:2335 , G4P N:9101 , HOH N:9215 , HOH N:9216BINDING SITE FOR RESIDUE MG N 9207
245ND2SOFTWAREGLU C:685 , ARG C:879 , MG C:9202 , MG C:9217 , ASN D:737 , ARG D:783 , LYS D:908 , ARG D:1029 , GLU D:1231 , THR D:1234 , GLN D:1235 , MG D:9204 , MG D:9214 , MG D:9216 , HOH D:9563 , HOH N:2390 , HOH N:9210 , HOH N:9211 , HOH N:9212 , HOH N:9217 , HOH N:9218 , HOH N:9936BINDING SITE FOR RESIDUE G4P N 9100
246ND3SOFTWAREGLU M:685 , SER M:878 , ARG M:879 , HOH M:2373 , MG M:9206 , HOH M:9607 , GLU N:734 , ASN N:737 , ARG N:783 , LYS N:908 , GLY N:1027 , ARG N:1029 , GLU N:1231 , THR N:1234 , GLN N:1235 , HOH N:2148 , MG N:9207 , HOH N:9213 , HOH N:9215 , HOH N:9216 , HOH N:9234 , HOH N:9248BINDING SITE FOR RESIDUE G4P N 9101
247OC1SOFTWAREGLU C:177 , ASN C:179 , HOH C:9825 , HOH N:9975BINDING SITE FOR RESIDUE MG C 9507
248OC2SOFTWAREASP C:323 , ASP C:324 , ASN C:330 , MG C:9367 , HOH C:9923BINDING SITE FOR RESIDUE MG C 9509
249OC3SOFTWARELYS C:103 , ASP C:104 , HOH C:9779BINDING SITE FOR RESIDUE MG C 9511
250OC4SOFTWAREVAL C:23 , HOH C:2118BINDING SITE FOR RESIDUE MG C 9514
251OC5SOFTWAREMG C:9259 , MG C:9411BINDING SITE FOR RESIDUE MG C 9519
252OC6SOFTWAREARG C:5 , GLU C:585BINDING SITE FOR RESIDUE MG C 9522
253OC7SOFTWAREHOH C:2325 , HOH C:2457 , HOH C:2814BINDING SITE FOR RESIDUE MG C 9524
254OC8SOFTWARELYS C:750 , GLU C:796 , GLY C:797 , HOH C:9969BINDING SITE FOR RESIDUE MG C 9525
255OC9SOFTWAREARG C:8 , MG C:9345 , HOH C:9904BINDING SITE FOR RESIDUE MG C 9534
256PC1SOFTWAREARG C:243BINDING SITE FOR RESIDUE MG C 9542
257PC2SOFTWAREHOH C:9768BINDING SITE FOR RESIDUE MG C 9549
258PC3SOFTWARELYS C:1024 , HOH C:2071BINDING SITE FOR RESIDUE MG C 9550
259PC4SOFTWAREALA C:423 , VAL C:427 , HOH C:2372BINDING SITE FOR RESIDUE MG C 9553
260PC5SOFTWAREILE C:108BINDING SITE FOR RESIDUE MG C 9554
261PC6SOFTWAREHOH C:2203BINDING SITE FOR RESIDUE MG C 9561
262PC7SOFTWARECYS D:58 , CYS D:60 , CYS D:73 , CYS D:76BINDING SITE FOR RESIDUE ZN D 9102
263PC8SOFTWARECYS D:1112 , CYS D:1194 , CYS D:1201 , CYS D:1204BINDING SITE FOR RESIDUE ZN D 9103
264PC9SOFTWAREASP D:739 , ASP D:741 , ASP D:743 , MG D:9355BINDING SITE FOR RESIDUE MG D 9201
265QC1SOFTWAREASP C:686 , ASP D:739 , ASP D:741BINDING SITE FOR RESIDUE MG D 9203
266QC2SOFTWAREARG D:783 , G4P N:9100 , HOH N:9212BINDING SITE FOR RESIDUE MG D 9204
267QC3SOFTWARELEU D:1348 , VAL D:1371 , VAL D:1372 , MET D:1375BINDING SITE FOR RESIDUE MG D 9208
268QC4SOFTWAREGLU D:734 , SER D:782 , HOH D:2403BINDING SITE FOR RESIDUE MG D 9211
269QC5SOFTWARELYS D:908 , HOH D:2986 , HOH N:2390 , G4P N:9100BINDING SITE FOR RESIDUE MG D 9214
270QC6SOFTWARELEU D:1160 , ARG D:1164 , ASP D:1170 , HOH D:2063BINDING SITE FOR RESIDUE MG D 9215
271QC7SOFTWAREG4P N:9100BINDING SITE FOR RESIDUE MG D 9216
272QC8SOFTWARELEU D:465 , PRO D:509 , GLU D:510 , TRP D:511 , MET D:512 , ILE D:513BINDING SITE FOR RESIDUE MG D 9218
273QC9SOFTWARESER D:429 , ASP D:430 , VAL D:431 , TYR D:432 , HOH D:2014 , MG D:9294BINDING SITE FOR RESIDUE MG D 9220
274RC1SOFTWARETHR D:1196 , ARG D:1197 , TYR D:1198 , GLY D:1199BINDING SITE FOR RESIDUE MG D 9225
275RC2SOFTWAREGLY D:418 , ASP D:419 , HOH D:2315 , HOH K:1813 , HOH K:2111 , HOH K:2890BINDING SITE FOR RESIDUE MG D 9226
276RC3SOFTWAREILE D:827 , ASP D:862 , VAL D:863BINDING SITE FOR RESIDUE MG D 9232
277RC4SOFTWAREILE D:956 , LYS D:960 , SER D:1060 , GLU D:1063 , MG D:9455 , HOH D:9638BINDING SITE FOR RESIDUE MG D 9233
278RC5SOFTWARELYS D:1047 , PRO D:1048 , LYS D:1079 , HOH D:9744BINDING SITE FOR RESIDUE MG D 9234
279RC6SOFTWAREGLU C:685 , CYS D:733 , ALA D:738 , HOH N:9208BINDING SITE FOR RESIDUE MG D 9236
280RC7SOFTWARELEU D:639 , SER D:765 , ALA D:766BINDING SITE FOR RESIDUE MG D 9237
281RC8SOFTWAREASN D:1010 , GLU D:1013 , ASN D:1014 , HOH D:2411BINDING SITE FOR RESIDUE MG D 9240
282RC9SOFTWARELEU D:250 , HOH D:2004 , HOH D:2447 , HOH D:2469 , MG D:9265BINDING SITE FOR RESIDUE MG D 9241
283SC1SOFTWAREGLY D:1218 , ALA D:1474 , GLY D:1475 , THR D:1476 , TYR E:17BINDING SITE FOR RESIDUE MG D 9242
284SC2SOFTWAREHOH D:2064 , HOH D:2924BINDING SITE FOR RESIDUE MG D 9246
285SC3SOFTWARETYR D:215 , VAL D:216 , LYS D:217 , HIS D:388 , GLU D:389BINDING SITE FOR RESIDUE MG D 9247
286SC4SOFTWAREPHE D:251BINDING SITE FOR RESIDUE MG D 9248
287SC5SOFTWAREALA D:379 , HOH D:2328BINDING SITE FOR RESIDUE MG D 9252
288SC6SOFTWAREALA D:735 , PHE D:736 , ASN D:737 , HOH D:2221BINDING SITE FOR RESIDUE MG D 9253
289SC7SOFTWAREARG D:1213 , HOH D:2272 , MG D:9498 , HOH D:9594BINDING SITE FOR RESIDUE MG D 9258
290SC8SOFTWAREILE D:32 , MET D:527 , MG D:9546BINDING SITE FOR RESIDUE MG D 9261
291SC9SOFTWAREHIS D:696 , GLY D:697 , ASN E:59BINDING SITE FOR RESIDUE MG D 9262
292TC1SOFTWARELEU D:250 , MG D:9241BINDING SITE FOR RESIDUE MG D 9265
293TC2SOFTWAREGLN D:1441 , ASN D:1442 , HOH D:3067BINDING SITE FOR RESIDUE MG D 9269
294TC3SOFTWARELEU D:964 , ARG D:1058 , HOH D:3009BINDING SITE FOR RESIDUE MG D 9271
295TC4SOFTWAREMET D:869 , GLU D:893 , HOH D:2336BINDING SITE FOR RESIDUE MG D 9274
296TC5SOFTWAREARG D:150 , LEU D:468 , HOH D:3301BINDING SITE FOR RESIDUE MG D 9276
297TC6SOFTWAREGLU C:551 , GLY D:1064 , LEU D:1065 , THR D:1066BINDING SITE FOR RESIDUE MG D 9277
298TC7SOFTWAREPRO D:208 , ARG D:209 , HOH D:2352 , HOH D:2429BINDING SITE FOR RESIDUE MG D 9279
299TC8SOFTWAREARG D:87 , TYR D:88 , LEU D:524BINDING SITE FOR RESIDUE MG D 9283
300TC9SOFTWARETYR D:163 , GLU D:436BINDING SITE FOR RESIDUE MG D 9285
301UC1SOFTWAREVAL D:829 , ALA D:830 , HOH D:9944BINDING SITE FOR RESIDUE MG D 9286
302UC2SOFTWARETHR D:1004 , ARG D:1036BINDING SITE FOR RESIDUE MG D 9291
303UC3SOFTWAREARG D:399 , SER D:429 , ASP D:430 , TYR D:432 , MG D:9220 , HOH D:9698BINDING SITE FOR RESIDUE MG D 9294
304UC4SOFTWARELEU C:952 , LYS C:971 , ASP D:953 , PRO D:1019 , HOH D:9611BINDING SITE FOR RESIDUE MG D 9296
305UC5SOFTWARETHR D:1382 , ALA D:1416 , TRP D:1417 , LYS D:1418BINDING SITE FOR RESIDUE MG D 9301
306UC6SOFTWARETRP D:1417BINDING SITE FOR RESIDUE MG D 9304
307UC7SOFTWAREPRO D:39 , ASP D:46 , GLU D:47BINDING SITE FOR RESIDUE MG D 9307
308UC8SOFTWAREGLN D:1235 , MG D:9317 , MG D:9393BINDING SITE FOR RESIDUE MG D 9308
309UC9SOFTWAREASN D:1116 , ARG D:1189 , SER D:1190 , THR D:1193 , CYS D:1204BINDING SITE FOR RESIDUE MG D 9312
310VC1SOFTWARELEU D:223 , ARG D:224 , GLY D:364 , ASP D:365BINDING SITE FOR RESIDUE MG D 9314
311VC2SOFTWAREGLN A:16 , GLN D:1184BINDING SITE FOR RESIDUE MG D 9315
312VC3SOFTWAREMG D:9308 , MG D:9393BINDING SITE FOR RESIDUE MG D 9317
313VC4SOFTWAREASN D:33 , TYR D:34 , ARG D:35 , HOH D:2434 , GLU M:527BINDING SITE FOR RESIDUE MG D 9319
314VC5SOFTWAREGLN D:1359BINDING SITE FOR RESIDUE MG D 9322
315VC6SOFTWAREMG D:9535BINDING SITE FOR RESIDUE MG D 9325
316VC7SOFTWAREGLU D:1351 , LYS D:1354 , HOH D:2126 , HOH D:2827BINDING SITE FOR RESIDUE MG D 9331
317VC8SOFTWAREALA D:1438BINDING SITE FOR RESIDUE MG D 9332
318VC9SOFTWAREHOH D:3129 , HOH D:9894BINDING SITE FOR RESIDUE MG D 9333
319WC1SOFTWAREGLU D:1013 , HOH D:2246 , HOH D:2611 , MG D:9372BINDING SITE FOR RESIDUE MG D 9336
320WC2SOFTWAREGLY D:70 , GLU D:79 , HOH D:2046BINDING SITE FOR RESIDUE MG D 9337
321WC3SOFTWAREGLU D:891 , HOH D:2077 , HOH D:2492 , HOH D:2576 , MG D:9478BINDING SITE FOR RESIDUE MG D 9342
322WC4SOFTWAREGLU D:382 , GLY D:383BINDING SITE FOR RESIDUE MG D 9343
323WC5SOFTWAREVAL D:1400 , GLU D:1401 , HOH D:2089BINDING SITE FOR RESIDUE MG D 9349
324WC6SOFTWAREILE D:378 , HOH D:2848BINDING SITE FOR RESIDUE MG D 9350
325WC7SOFTWAREHIS P:170BINDING SITE FOR RESIDUE MG D 9351
326WC8SOFTWARELYS D:800 , ALA D:802 , LEU D:804 , VAL D:829BINDING SITE FOR RESIDUE MG D 9353
327WC9SOFTWAREMG D:9201BINDING SITE FOR RESIDUE MG D 9355
328XC1SOFTWAREHOH D:2412 , HOH D:2515 , HOH D:2662BINDING SITE FOR RESIDUE MG D 9357
329XC2SOFTWAREALA D:814 , HOH D:3250BINDING SITE FOR RESIDUE MG D 9360
330XC3SOFTWAREGLU D:476 , HOH D:2599 , HOH D:2942BINDING SITE FOR RESIDUE MG D 9361
331XC4SOFTWARELYS D:799 , HOH D:2312 , HOH D:2323BINDING SITE FOR RESIDUE MG D 9362
332XC5SOFTWAREHOH D:2786 , HOH D:3237 , LYS L:102 , HOH L:6572BINDING SITE FOR RESIDUE MG D 9363
333XC6SOFTWAREHOH D:2445BINDING SITE FOR RESIDUE MG D 9369
334XC7SOFTWAREASP D:892 , GLU D:893 , LYS D:894 , HOH D:2527BINDING SITE FOR RESIDUE MG D 9370
335XC8SOFTWAREMG D:9336BINDING SITE FOR RESIDUE MG D 9372
336XC9SOFTWAREASP D:542 , THR D:592 , HOH D:2979 , HOH D:9883BINDING SITE FOR RESIDUE MG D 9376
337YC1SOFTWAREASP D:1111 , CYS D:1112 , ARG D:1189BINDING SITE FOR RESIDUE MG D 9377
338YC2SOFTWAREVAL D:1055 , HOH D:2634 , HOH D:3062 , MG D:9470BINDING SITE FOR RESIDUE MG D 9379
339YC3SOFTWARESER D:1059 , GLU D:1063 , HOH D:2237 , HOH D:3141 , MG D:9455BINDING SITE FOR RESIDUE MG D 9380
340YC4SOFTWAREHOH D:2269 , HOH D:2514 , MG D:9499BINDING SITE FOR RESIDUE MG D 9384
341YC5SOFTWAREASP D:117 , LEU D:118BINDING SITE FOR RESIDUE MG D 9386
342YC6SOFTWAREGLY D:1298 , HOH D:2614 , MG D:9439BINDING SITE FOR RESIDUE MG D 9390
343YC7SOFTWARELYS P:226BINDING SITE FOR RESIDUE MG D 9391
344YC8SOFTWAREGLU D:1497 , LYS D:1500 , GLU D:1501 , HOH D:3058 , MG D:9515BINDING SITE FOR RESIDUE MG D 9392
345YC9SOFTWAREMG D:9308 , MG D:9317 , HOH N:2575BINDING SITE FOR RESIDUE MG D 9393
346ZC1SOFTWARELYS D:149 , ARG D:150 , HOH D:2013BINDING SITE FOR RESIDUE MG D 9399
347ZC2SOFTWARELYS N:1304BINDING SITE FOR RESIDUE MG D 9401
348ZC3SOFTWAREALA D:822 , HOH D:2804BINDING SITE FOR RESIDUE MG D 9402
349ZC4SOFTWAREPHE D:1299 , SER D:1300BINDING SITE FOR RESIDUE MG D 9403
350ZC5SOFTWAREARG D:534BINDING SITE FOR RESIDUE MG D 9404
351ZC6SOFTWAREASP D:406BINDING SITE FOR RESIDUE MG D 9406
352ZC7SOFTWARETYR D:1015 , HOH D:3281BINDING SITE FOR RESIDUE MG D 9409
353ZC8SOFTWAREARG D:1130 , HOH D:2581 , HOH D:9828BINDING SITE FOR RESIDUE MG D 9410
354ZC9SOFTWARETYR D:401 , VAL D:415 , ALA D:416 , ASN D:442 , HOH D:2959BINDING SITE FOR RESIDUE MG D 9416

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SMY)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Glu A:26 -Pro A:27
2Glu B:26 -Pro B:27
3Leu C:165 -Pro C:166
4Glu K:26 -Pro K:27
5Glu L:26 -Pro L:27
6Leu M:165 -Pro M:166

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SMY)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  2F:384-408
P:384-408
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  2C:836-848
M:836-848
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  1F:384-408
-
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1C:836-848
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  1-
P:384-408
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1-
M:836-848

(-) Exons   (0, 0)

(no "Exon" information available for 1SMY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1smya1 A:1-49,A:173-229 RNA polymerase alpha    d1smya2 A:50-172 RNA polymerase alpha subunit                                                                              d1smya1 A:1-49,A:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1smyA01 A:1-49,A:172-225                         1smyA02 A:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1smyA01 A:1-49,A:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeee.....eeeeeeee..hhhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhhh.eee......eeeeeeee......hhhhh.....eee...............eeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy A    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1smyb1 B:1-49,B:173-229 RNA polymerase alpha    d1smyb2 B:50-172 RNA polymerase alpha subunit                                                                              d1smyb1 B:1-49,B:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1smyB01 B:1-49,B:172-225                         1smyB02 B:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1smyB01 B:1-49,B:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhhh.eee......eeeeeeee......hhhhh.....eee...............eeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeee...........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy B    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain C from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d1smyc_ C: RNA-polymerase beta                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains -1smyC011smyC02 C:9-143,C:324-470,C:536-592  [code=3.90.1100.10, no name defined]                                                              1smyC03 C:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             1smyC02 C:9-143,C:324-470,C:536-592  [code=3.90.1100.10, no name defined]                                                                          1smyC04 C:471-535  [code=2.30.150.10, no name defined]           1smyC02 C:9-143,C:324-470,C:536-592                      1smyC05 C:593-667  [code=2.40.50.100, no name defined]                     1smyC01                        1smyC06 C:699-831  [code=2.40.50.150, no name defined]                                                                               1smyC01 C:2-8,C:668-698,C:832-1004  [code=2.40.270.10, no name defined]                                                                                                      ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh...........hhhhhhhhhhh.............eeeeeee......hhhhhhhh....ee..eeeeee.................ee.......ee....eeee.eeeee...ee.............ee..........eeeee...eeeee......hhhhhhhhhh.hhhhhhhhh...hhhhhhh..hhhhhhhhhhhhhhhhhhh.........hhhhhhh..............hhhhhhhhh....................hhhhhhhhhhhhh................eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhhhh.ee........................................ee......ee.....ee...ee.............hhhhhhh..ee...............eeee....eeee......ee..hhhhhh........hhhhhhhhhhhhhhhhhhh...........ee..hhhhhhhhh.........eee.........eee...eee................................................eeeeee...........eeeeehhhhhh....eeeeeeeeeeee....................hhhhh...............eee..ee.......hhhhhhhhhhhhh.....ee..ee.......eeeeeeee............eeeeeeeeeeeee......eee.....eeeeeeee...............eee..........hhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeeeeeee...hhhhh.eee.....................eeehhhhhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..eeeee................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy C    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain D from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d1smyd_ D: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..hhhhhhhheeee....................hhhhhh...............................hhhhhhheeeeeeeeeee.hhhh....hhhhhhh....hhhhhhhhh....ee..................hhhhhhhhhh...ee.......hhhhhhhhhhh........ee.......ee.....eee..................hhhhh...............----------------------------------------------------------------------------------------------------------------...........................eeee..eee..................................eeeee....eeeee......ee.hhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh...hhhh.eeeeeee.......eee.....eee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..................hhhhhhhh..hhhhhhh..eee..eeeeeeee.......ee..hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhh.eeeeee.......eee.hhhhh.........eeeee...hhhhhhhhhhhh...................hhhhhhhhhhh................hhhhhhhhhhhhh............hhhhhhhee.hhhhhhhhhhh.........eeee..eee..hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh................ee...ee........ee.hhhhhhhhhh.......ee....ee......hhhhhhhhhhhhhhh.....ee.hhhhh......hhhhhh.............hhhhhhhhhhhhhhh...................hhhhhhhhhhh..............eeeee........eeee....eeee..............ee...........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.eeee...........eehhhhhhhhhhhhhh........eee...hhhhhhhh..hhhhhh...hhhhhhhhhhhhh.eee..hhhhhhhh................eeeehhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy D    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain E from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d1smye_ E: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 1smyE00 E:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..hhhhhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhhhh...eeee....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1smy E    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain F from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1smyf3 F:74-257 Sigma70                                                                                                                                                                d1smyf1 F:258-318 Sigma70                                    d1smyf2 F:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1smyF02 F:260-313                                     -------------------------1smyF03 F:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhh..ee...........hhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...-----.........hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy F   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain F from PDB  Type:PROTEIN  Length:345
 aligned with SIGA_THET2 | Q72L95 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
          SIGA_THET2     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1smyf3 F:74-257 Sigma70                                                                                                                                                                d1smyf1 F:258-318 Sigma70                                    d1smyf2 F:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1smyF02 F:260-313                                     -------------------------1smyF03 F:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhh..ee...........hhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...-----.........hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIGMA70_2  PDB: F:384-408  --------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy F   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain K from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1smyk1 K:1-49,K:173-229 RNA polymerase alpha    d1smyk2 K:50-172 RNA polymerase alpha subunit                                                                              d1smyk1 K:1-49,K:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1smyK01 K:1-49,K:172-225                         1smyK02 K:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1smyK01 K:1-49,K:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhhh.eee......eeeeeeee......hhhhh.....eee...............eeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy K    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain L from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1smyl1 L:1-49,L:173-229 RNA polymerase alpha    d1smyl2 L:50-172 RNA polymerase alpha subunit                                                                              d1smyl1 L:1-49,L:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1smyL01 L:1-49,L:172-225                         1smyL02 L:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1smyL01 L:1-49,L:172-225                              ---- CATH domains
           Pfam domains (1) ------------------------RNA_pol_L-1smyL01 L:25-223                                                                                                                                                                             ------ Pfam domains (1)
           Pfam domains (2) ------------------------RNA_pol_L-1smyL02 L:25-223                                                                                                                                                                             ------ Pfam domains (2)
           Pfam domains (3) ------------------------RNA_pol_L-1smyL03 L:25-223                                                                                                                                                                             ------ Pfam domains (3)
           Pfam domains (4) ------------------------RNA_pol_L-1smyL04 L:25-223                                                                                                                                                                             ------ Pfam domains (4)
           Pfam domains (5) ---------------------------------------------------RNA_pol_A_bac-1smyL05 L:52-180                                                                                                   ------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ---------------------------------------------------RNA_pol_A_bac-1smyL06 L:52-180                                                                                                   ------------------------------------------------- Pfam domains (6)
           Pfam domains (7) ---------------------------------------------------RNA_pol_A_bac-1smyL07 L:52-180                                                                                                   ------------------------------------------------- Pfam domains (7)
           Pfam domains (8) ---------------------------------------------------RNA_pol_A_bac-1smyL08 L:52-180                                                                                                   ------------------------------------------------- Pfam domains (8)
         Sec.struct. author ...........eee......eeeeeeee..hhhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhhh.eee......eeeeeeee......hhhhh.....eee...............eeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy L    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain M from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d1smym_ M: RNA-polymerase beta                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains -1smyM011smyM02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                              1smyM03 M:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             1smyM02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                                          1smyM04 M:471-535  [code=2.30.150.10, no name defined]           1smyM02 M:9-143,M:324-470,M:536-592                      1smyM05 M:593-667  [code=2.40.50.100, no name defined]                     1smyM01                        1smyM06 M:699-831  [code=2.40.50.150, no name defined]                                                                               1smyM01 M:2-8,M:668-698,M:832-1004  [code=2.40.270.10, no name defined]                                                                                                      ------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------RNA_pol_Rpb2_1-1smyM03 M:17-389                                                                                                                                                                                                                                                                                                                                                      ---RNA_pol_Rpb2_3-1smyM07 M:393-462                                      --------RNA_pol_Rpb2_45-1smyM09 M:471-535                                -----RNA_pol_Rpb2_6-1smyM01 M:541-1026                                                                                                                                                                                                                                                                                                                                                                                                                                                                     -RNA_pol_Rpb2_7-1smyM11 M:1028-1104                                           --------------- Pfam domains (1)
           Pfam domains (2) ----------------RNA_pol_Rpb2_1-1smyM04 M:17-389                                                                                                                                                                                                                                                                                                                                                      ---RNA_pol_Rpb2_3-1smyM08 M:393-462                                      --------RNA_pol_Rpb2_45-1smyM10 M:471-535                                -----RNA_pol_Rpb2_6-1smyM02 M:541-1026                                                                                                                                                                                                                                                                                                                                                                                                                                                                     -RNA_pol_Rpb2_7-1smyM12 M:1028-1104                                           --------------- Pfam domains (2)
           Pfam domains (3) ---------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb2_2-1smyM05 M:142-334                                                                                                                                                                 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ---------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb2_2-1smyM06 M:142-334                                                                                                                                                                 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .eeee.............hhhhhhhhhhhh...........hhhhhhhhhhh.............eeeeeee......hhhhhhhh....ee..eeeeee.................ee.......ee....eeee.eeeee...ee.............ee..........eeeee...eeeee......hhhhhhhhhh.hhhhhhhhhh..hhhhhhh..hhhhhhhhhhhhhhhhhhh.........hhhhhhh..............hhhhhhhhh....................hhhhhhhhhhhhh................eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhhhh.ee........................................ee......ee.....ee..eee.............hhhhhhh..ee...............eeee....eeee......eee.hhhhhh........hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh.........eee.........eee...eee...............................................eeeeeee...........eeeeehhhhhh....eeeeeeeeeeee....................hhhhh...............eee..ee.......hhhhhhhhhhhhh.....ee..ee.......eeeeeeee............eeeeeeeeeeeee......eee.....eeeeeeee...............eee..........hhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeeeeeee...hhhhh.eee.....................eeehhhhhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..eeeee................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy M    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain N from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d1smyn_ N: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_1-1smyN01 N:417-618                                                                                                                                                                          -RNA_pol_Rpb1_2-1smyN05 N:620-765                                                                                                                  --RNA_pol_Rpb1_3-1smyN07 N:768-954                                                                                                                                                           ----------------------------RNA_pol_Rpb1_4-1smyN09 N:983-1066                                                   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_1-1smyN02 N:417-618                                                                                                                                                                          -RNA_pol_Rpb1_2-1smyN06 N:620-765                                                                                                                  --RNA_pol_Rpb1_3-1smyN08 N:768-954                                                                                                                                                           ----------------------------RNA_pol_Rpb1_4-1smyN10 N:983-1066                                                   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_1-1smyN03 N:417-618                                                                                                                                                                          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_5-1smyN11 N:1064-1437                                                                                                                                                                                                                                                                                                                                                    -------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_1-1smyN04 N:417-618                                                                                                                                                                          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_pol_Rpb1_5-1smyN12 N:1064-1437                                                                                                                                                                                                                                                                                                                                                    -------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .....eeeee..hhhhhhhheeee....................hhhhhh...............................hhhhhhheeeeeeeeeee.hhhh....hhhhhhh....hhhhhhhhh....ee..................hhhhhhhhhh...ee.......hhhhhhhhhhh........ee.......ee.....eee..................hhhhh...............----------------------------------------------------------------------------------------------------------------...........................eeee..eee..................................eeeee....eeeee......ee.hhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh...hhhh.eeeeeee.......eee.....eee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..................hhhhhhhh..hhhhhhh..eee..eeeeeeee.......ee..hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhh.eeeeee.......eee.hhhhh.........eeeee...hhhhhhhhhhhhhhhhh..............hhhhhhhhhhh................hhhhhhhhhhhhh............hhhhhhhee.hhhhhhhhhhh.........eeee..eee..hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh................ee...ee........ee.hhhhhhhhhh.......ee....ee......hhhhhhhhhhhhhhh.....ee.hhhhh......hhhhhh.............hhhhhhhhhhhhhhh...................hhhhhhhhhhh..............eeeee........eeee....eeee..............ee...........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.eeee...........eehhhhhhhhhhhhhh........eee...hhhhhhhh..hhhhhh...hhhhhhhhhhhhheeee..hhhhhhhh................eeeehhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy N    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain O from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d1smyo_ O: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 1smyO00 O:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
           Pfam domains (1) -----RNA_pol_Rpb6-1smyO01 O:7-57                        --------------------------------------- Pfam domains (1)
           Pfam domains (2) -----RNA_pol_Rpb6-1smyO02 O:7-57                        --------------------------------------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhh..hhhhhhhhhhhhhhhh.....................hhhhh...hhhhhhhhhh...eeee....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1smy O    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain P from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1smyp3 P:74-257 Sigma70                                                                                                                                                                d1smyp1 P:258-318 Sigma70                                    d1smyp2 P:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1smyP02 P:260-313                                     -------------------------1smyP03 P:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhh..ee...........hhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...-----.........hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy P   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain P from PDB  Type:PROTEIN  Length:345
 aligned with SIGA_THET2 | Q72L95 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
          SIGA_THET2     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1smyp3 P:74-257 Sigma70                                                                                                                                                                d1smyp1 P:258-318 Sigma70                                    d1smyp2 P:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1smyP02 P:260-313                                     -------------------------1smyP03 P:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhh..ee...........hhhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...-----.........hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIGMA70_2  PDB: P:384-408  --------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1smy P   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (8, 20)

Asymmetric Unit

(-) CATH Domains  (10, 26)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (14, 34)

Asymmetric Unit

(-) Gene Ontology  (15, 41)

Asymmetric Unit(hide GO term definitions)
Chain A,B,K,L   (RPOA_THETH | Q9Z9H6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain C,M   (RPOB_THET8 | Q8RQE9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0032549    ribonucleoside binding    Interacting selectively and non-covalently with a ribonucleoside, a compound consisting of a purine or pyrimidine nitrogenous base linked to ribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain D,N   (RPOC_THET8 | Q8RQE8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain E,O   (RPOZ_THET8 | Q8RQE7)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain F,P   (SIGA_THET2 | Q72L95)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0016987    sigma factor activity    A sigma factor is the promoter specificity subunit of eubacterial-type multisubunit RNA polymerases, those whose core subunit composition is often described as alpha(2)-beta-beta-prime. (This type of multisubunit RNA polymerase complex is known to be found in eubacteria and plant plastids). Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, this binds specifically to promoter sequences, with the sigma factor making sequence specific contacts with the promoter elements. The sigma subunit is released from the elongating form of the polymerase and is thus free to act catalytically for multiple RNA polymerase core enzymes.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001123    transcription initiation from bacterial-type RNA polymerase promoter    Any process involved in the assembly of bacterial-type RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain F,P   (Q5SKW1_THET8 | Q5SKW1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016987    sigma factor activity    A sigma factor is the promoter specificity subunit of eubacterial-type multisubunit RNA polymerases, those whose core subunit composition is often described as alpha(2)-beta-beta-prime. (This type of multisubunit RNA polymerase complex is known to be found in eubacteria and plant plastids). Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, this binds specifically to promoter sequences, with the sigma factor making sequence specific contacts with the promoter elements. The sigma subunit is released from the elongating form of the polymerase and is thus free to act catalytically for multiple RNA polymerase core enzymes.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001123    transcription initiation from bacterial-type RNA polymerase promoter    Any process involved in the assembly of bacterial-type RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    G4P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    HD9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    ID1  [ RasMol ]  +environment [ RasMol ]
    ID2  [ RasMol ]  +environment [ RasMol ]
    ID3  [ RasMol ]  +environment [ RasMol ]
    ID4  [ RasMol ]  +environment [ RasMol ]
    ID5  [ RasMol ]  +environment [ RasMol ]
    ID6  [ RasMol ]  +environment [ RasMol ]
    ID7  [ RasMol ]  +environment [ RasMol ]
    ID8  [ RasMol ]  +environment [ RasMol ]
    ID9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    JD1  [ RasMol ]  +environment [ RasMol ]
    JD2  [ RasMol ]  +environment [ RasMol ]
    JD3  [ RasMol ]  +environment [ RasMol ]
    JD4  [ RasMol ]  +environment [ RasMol ]
    JD5  [ RasMol ]  +environment [ RasMol ]
    JD6  [ RasMol ]  +environment [ RasMol ]
    JD7  [ RasMol ]  +environment [ RasMol ]
    JD8  [ RasMol ]  +environment [ RasMol ]
    JD9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    KD1  [ RasMol ]  +environment [ RasMol ]
    KD2  [ RasMol ]  +environment [ RasMol ]
    KD3  [ RasMol ]  +environment [ RasMol ]
    KD4  [ RasMol ]  +environment [ RasMol ]
    KD5  [ RasMol ]  +environment [ RasMol ]
    KD6  [ RasMol ]  +environment [ RasMol ]
    KD7  [ RasMol ]  +environment [ RasMol ]
    KD8  [ RasMol ]  +environment [ RasMol ]
    KD9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    LD1  [ RasMol ]  +environment [ RasMol ]
    LD2  [ RasMol ]  +environment [ RasMol ]
    LD3  [ RasMol ]  +environment [ RasMol ]
    LD4  [ RasMol ]  +environment [ RasMol ]
    LD5  [ RasMol ]  +environment [ RasMol ]
    LD6  [ RasMol ]  +environment [ RasMol ]
    LD7  [ RasMol ]  +environment [ RasMol ]
    LD8  [ RasMol ]  +environment [ RasMol ]
    LD9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    MD1  [ RasMol ]  +environment [ RasMol ]
    MD2  [ RasMol ]  +environment [ RasMol ]
    MD3  [ RasMol ]  +environment [ RasMol ]
    MD4  [ RasMol ]  +environment [ RasMol ]
    MD5  [ RasMol ]  +environment [ RasMol ]
    MD6  [ RasMol ]  +environment [ RasMol ]
    MD7  [ RasMol ]  +environment [ RasMol ]
    MD8  [ RasMol ]  +environment [ RasMol ]
    MD9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    ND1  [ RasMol ]  +environment [ RasMol ]
    ND2  [ RasMol ]  +environment [ RasMol ]
    ND3  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:26 - Pro A:27   [ RasMol ]  
    Glu B:26 - Pro B:27   [ RasMol ]  
    Glu K:26 - Pro K:27   [ RasMol ]  
    Glu L:26 - Pro L:27   [ RasMol ]  
    Leu C:165 - Pro C:166   [ RasMol ]  
    Leu M:165 - Pro M:166   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1smy
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SKW1_THET8 | Q5SKW1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  RPOA_THETH | Q9Z9H6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPOB_THET8 | Q8RQE9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPOC_THET8 | Q8RQE8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPOZ_THET8 | Q8RQE7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SIGA_THET2 | Q72L95
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Inf