Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE RNA POLYMERASE HOLOENZYME FROM THERMUS THERMOPHILUS AT 2.6A RESOLUTION
 
Authors :  Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  22 Apr 02  (Deposition) - 26 Jun 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,K,L,M,N,O,P
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  K,L,M,N,O,P  (1x)
Keywords :  Rna Polymerase Holoenzyme, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. G. Vassylyev, S. Sekine, O. Laptenko, J. Lee, M. N. Vassylyeva, S. Borukhov, S. Yokoyama
Crystal Structure Of A Bacterial Rna Polymerase Holoenzyme At 2. 6 A Resolution
Nature V. 417 712 2002
PubMed-ID: 12000971  |  Reference-DOI: 10.1038/NATURE752
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RNA POLYMERASE ALPHA SUBUNIT
    ChainsA, B, K, L
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 2 - RNA POLYMERASE BETA SUBUNIT
    ChainsC, M
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 3 - RNA POLYMERASE BETA SUBUNIT
    ChainsD, N
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 4 - RNA POLYMERASE OMEGA SUBUNIT
    ChainsE, O
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 5 - RNA POLYMERASE SIGMA-70 SUBUNIT
    ChainsF, P
    EC Number2.7.7.6
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFKLMNOP
Biological Unit 1 (1x)ABCDEF      
Biological Unit 2 (1x)      KLMNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 489)

Asymmetric Unit (2, 489)
No.NameCountTypeFull Name
1MG485Ligand/IonMAGNESIUM ION
2PB4Ligand/IonLEAD (II) ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2PB-1Ligand/IonLEAD (II) ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2PB-1Ligand/IonLEAD (II) ION

(-) Sites  (447, 447)

Asymmetric Unit (447, 447)
No.NameEvidenceResiduesDescription
001AC1SOFTWARETHR A:51 , ALA A:52 , VAL A:170 , HOH A:9470 , HOH A:9472 , HOH A:9483 , HOH A:9624BINDING SITE FOR RESIDUE MG A 9001
002AC2SOFTWAREARG A:14 , MG A:9309 , MG A:9311 , HOH B:9603 , HOH D:9609BINDING SITE FOR RESIDUE MG A 9004
003AC3SOFTWAREARG A:30 , GLY A:31 , PHE A:32 , SER B:46BINDING SITE FOR RESIDUE MG A 9018
004AC4SOFTWAREASN A:91 , PRO A:92 , LEU A:94 , GLN A:95BINDING SITE FOR RESIDUE MG A 9045
005AC5SOFTWAREARG A:161 , HOH A:9508 , HOH A:9521BINDING SITE FOR RESIDUE MG A 9072
006AC6SOFTWAREARG A:112 , GLU D:1154BINDING SITE FOR RESIDUE MG A 9073
007AC7SOFTWARELEU A:62 , SER A:66 , HOH C:2166BINDING SITE FOR RESIDUE MG A 9088
008AC8SOFTWARELEU A:90 , ALA A:118 , ASP A:119 , HOH A:9566BINDING SITE FOR RESIDUE MG A 9092
009AC9SOFTWAREASP A:119 , HOH A:9566BINDING SITE FOR RESIDUE MG A 9098
010AD1SOFTWAREHIS F:143 , ASP F:152BINDING SITE FOR RESIDUE MG F 9328
011AD2SOFTWAREMG F:9416BINDING SITE FOR RESIDUE MG F 9330
012AD3SOFTWARELEU F:354 , GLU F:355 , LEU F:358BINDING SITE FOR RESIDUE MG F 9344
013AD4SOFTWAREHOH F:9492BINDING SITE FOR RESIDUE MG F 9354
014AD5SOFTWARELEU F:308 , GLN F:312 , HOH F:9730BINDING SITE FOR RESIDUE MG F 9356
015AD6SOFTWAREARG F:414 , ARG F:416BINDING SITE FOR RESIDUE MG F 9362
016AD7SOFTWAREHOH F:9600 , HOH F:9695BINDING SITE FOR RESIDUE MG F 9364
017AD8SOFTWAREMG F:9330 , HOH F:9492BINDING SITE FOR RESIDUE MG F 9416
018AD9SOFTWAREHOH F:9706BINDING SITE FOR RESIDUE MG F 9418
019BC1SOFTWAREGLU A:216 , HOH A:9459BINDING SITE FOR RESIDUE MG A 9119
020BC2SOFTWARELYS A:7 , GLN A:188 , MG A:9329 , HOH A:9462 , HOH A:9475BINDING SITE FOR RESIDUE MG A 9144
021BC3SOFTWAREVAL A:117 , ALA A:118 , ASP A:119BINDING SITE FOR RESIDUE MG A 9155
022BC4SOFTWAREMG A:9004 , HOH A:9513 , HOH A:9556BINDING SITE FOR RESIDUE MG A 9309
023BC5SOFTWAREARG A:14 , MG A:9004 , HOH B:9479 , HOH B:9557 , HOH B:9603 , HOH D:9609BINDING SITE FOR RESIDUE MG A 9311
024BC6SOFTWARELYS A:7 , LEU A:186 , GLN A:188 , MG A:9144 , HOH A:9447BINDING SITE FOR RESIDUE MG A 9329
025BC7SOFTWAREASP A:60BINDING SITE FOR RESIDUE MG A 9351
026BC8SOFTWAREASP B:168 , HOH B:9521 , VAL D:842 , HOH D:2600 , HOH D:9819BINDING SITE FOR RESIDUE MG B 9009
027BC9SOFTWARELEU B:6 , MG B:9061 , HOH B:9535 , HOH B:9538 , HOH B:9593BINDING SITE FOR RESIDUE MG B 9047
028BD1SOFTWAREHOH F:9728BINDING SITE FOR RESIDUE MG F 9424
029BD2SOFTWAREGLY M:156 , ARG M:157 , TYR M:158 , HOH M:9701BINDING SITE FOR RESIDUE MG F 9429
030BD3SOFTWARETYR F:410BINDING SITE FOR RESIDUE MG F 9437
031BD4SOFTWAREHOH F:9484 , HOH F:9591 , ARG K:189 , LEU K:192BINDING SITE FOR RESIDUE MG F 9474
032BD5SOFTWAREHOH F:9690BINDING SITE FOR RESIDUE MG F 9475
033BD6SOFTWAREVAL K:170 , HOH K:1859BINDING SITE FOR RESIDUE MG K 9158
034BD7SOFTWAREVAL K:120 , HOH N:9681 , HOH N:9795BINDING SITE FOR RESIDUE MG K 9165
035BD8SOFTWARELYS K:159 , ASP K:160 , ARG K:161 , ILE K:162BINDING SITE FOR RESIDUE MG K 9178
036BD9SOFTWAREHOH K:3553BINDING SITE FOR RESIDUE MG K 9187
037CC1SOFTWAREPHE B:65 , SER B:66 , THR B:67 , ASP B:74BINDING SITE FOR RESIDUE MG B 9060
038CC2SOFTWARELYS B:7 , MG B:9047 , MG B:9326 , HOH B:9538 , HOH B:9597 , HOH B:9643BINDING SITE FOR RESIDUE MG B 9061
039CC3SOFTWAREVAL B:181 , HOH C:2029BINDING SITE FOR RESIDUE MG B 9085
040CC4SOFTWAREGLU B:133 , HOH B:9530 , HOH B:9546BINDING SITE FOR RESIDUE MG B 9091
041CC5SOFTWAREPRO B:49 , PRO B:173 , VAL B:205 , HOH B:9537BINDING SITE FOR RESIDUE MG B 9106
042CC6SOFTWAREMG B:9361BINDING SITE FOR RESIDUE MG B 9114
043CC7SOFTWAREHOH B:9532BINDING SITE FOR RESIDUE MG B 9133
044CC8SOFTWAREARG B:14 , GLN B:16 , MG B:9336 , HOH B:9601 , HOH B:9624BINDING SITE FOR RESIDUE MG B 9137
045CC9SOFTWARELYS N:475BINDING SITE FOR RESIDUE MG B 9140
046CD1SOFTWARELEU K:45 , SER K:172 , MG K:9471BINDING SITE FOR RESIDUE MG K 9198
047CD2SOFTWAREARG K:88 , LEU K:90 , GLU K:121BINDING SITE FOR RESIDUE MG K 9201
048CD3SOFTWAREHOH K:2135 , HOH K:2295 , VAL L:10BINDING SITE FOR RESIDUE MG K 9239
049CD4SOFTWAREARG K:185BINDING SITE FOR RESIDUE MG K 9280
050CD5SOFTWARELEU K:62 , ASN K:163 , ARG M:744 , ILE M:745 , GLY M:746BINDING SITE FOR RESIDUE MG K 9284
051CD6SOFTWAREHOH K:2851BINDING SITE FOR RESIDUE MG K 9285
052CD7SOFTWAREHOH K:2726 , HOH K:4517 , HOH K:4894BINDING SITE FOR RESIDUE MG K 9369
053CD8SOFTWAREGLU K:29 , ARG K:30BINDING SITE FOR RESIDUE MG K 9376
054CD9SOFTWAREHOH K:1149 , HOH K:2105 , MG K:9440BINDING SITE FOR RESIDUE MG K 9377
055DC1SOFTWAREHOH D:2169BINDING SITE FOR RESIDUE MG B 9310
056DC2SOFTWAREPRO B:27 , LEU B:186 , MG B:9061 , HOH B:9597BINDING SITE FOR RESIDUE MG B 9326
057DC3SOFTWAREMG B:9137 , HOH B:9624BINDING SITE FOR RESIDUE MG B 9336
058DC4SOFTWAREASP B:126BINDING SITE FOR RESIDUE MG B 9337
059DC5SOFTWAREGLU N:467 , HOH N:9761BINDING SITE FOR RESIDUE MG B 9341
060DC6SOFTWAREASP B:3BINDING SITE FOR RESIDUE MG B 9343
061DC7SOFTWARETHR B:15 , LEU B:208 , HOH B:9488BINDING SITE FOR RESIDUE MG B 9348
062DC8SOFTWAREGLU B:108BINDING SITE FOR RESIDUE MG B 9352
063DC9SOFTWAREMG B:9114 , GLU P:157BINDING SITE FOR RESIDUE MG B 9361
064DD1SOFTWAREHOH K:2105 , MG K:9377BINDING SITE FOR RESIDUE MG K 9440
065DD2SOFTWARELYS K:155BINDING SITE FOR RESIDUE MG K 9445
066DD3SOFTWAREGLU K:216BINDING SITE FOR RESIDUE MG K 9464
067DD4SOFTWAREVAL K:170 , MG K:9198 , LYS M:696BINDING SITE FOR RESIDUE MG K 9471
068DD5SOFTWARETYR K:57BINDING SITE FOR RESIDUE MG K 9473
069DD6SOFTWAREARG L:42 , HOH N:9904BINDING SITE FOR RESIDUE MG L 9166
070DD7SOFTWAREASN L:81 , GLU L:84 , LEU L:127 , HOH N:2316BINDING SITE FOR RESIDUE MG L 9174
071DD8SOFTWARELEU L:186 , ARG L:189 , HOH L:2223BINDING SITE FOR RESIDUE MG L 9197
072DD9SOFTWAREHOH D:2359BINDING SITE FOR RESIDUE MG L 9209
073EC1SOFTWAREHOH B:9549BINDING SITE FOR RESIDUE MG B 9417
074EC2SOFTWAREHOH B:9665BINDING SITE FOR RESIDUE MG B 9427
075EC3SOFTWARELYS B:110BINDING SITE FOR RESIDUE MG B 9477
076EC4SOFTWAREASP C:653 , HOH C:9784BINDING SITE FOR RESIDUE MG C 9006
077EC5SOFTWARELYS C:930 , PHE C:934 , GLY C:935BINDING SITE FOR RESIDUE MG C 9007
078EC6SOFTWAREARG C:84 , ARG C:626 , TYR C:629 , HOH C:9724BINDING SITE FOR RESIDUE MG C 9011
079EC7SOFTWAREASP C:481BINDING SITE FOR RESIDUE MG C 9012
080EC8SOFTWAREARG C:517 , LYS C:518 , GLY C:519 , GLU C:520BINDING SITE FOR RESIDUE MG C 9015
081EC9SOFTWAREMET C:1 , HOH C:2115 , MG C:9321 , HOH C:9835BINDING SITE FOR RESIDUE MG C 9025
082ED1SOFTWAREHOH K:1278 , GLN L:229BINDING SITE FOR RESIDUE MG L 9219
083ED2SOFTWAREASP L:168 , HOH L:2107 , LYS N:840 , VAL N:842 , MG N:9195BINDING SITE FOR RESIDUE MG L 9222
084ED3SOFTWAREHOH D:9815 , LYS L:102 , HOH L:1881 , HOH L:2997BINDING SITE FOR RESIDUE MG L 9236
085ED4SOFTWAREGLU L:104BINDING SITE FOR RESIDUE MG L 9240
086ED5SOFTWAREGLY L:203 , HOH L:1060BINDING SITE FOR RESIDUE MG L 9250
087ED6SOFTWARELYS L:83 , TYR L:150 , ASP L:168 , VAL N:842 , PHE N:843BINDING SITE FOR RESIDUE MG L 9256
088ED7SOFTWAREMG L:9409BINDING SITE FOR RESIDUE MG L 9260
089ED8SOFTWARELYS D:138 , HOH D:9910BINDING SITE FOR RESIDUE MG L 9304
090ED9SOFTWARELYS L:7 , HOH L:1022 , HOH L:3005BINDING SITE FOR RESIDUE MG L 9393
091FC1SOFTWAREVAL C:743 , ARG C:744 , ILE C:745 , HOH C:9689 , HOH C:9745BINDING SITE FOR RESIDUE MG C 9029
092FC2SOFTWAREHOH C:2348BINDING SITE FOR RESIDUE MG C 9030
093FC3SOFTWARELYS C:103 , ASP C:104 , HOH C:9759BINDING SITE FOR RESIDUE MG C 9036
094FC4SOFTWAREARG C:265BINDING SITE FOR RESIDUE MG C 9041
095FC5SOFTWARESER C:1117 , LYS C:1118 , HOH C:9544BINDING SITE FOR RESIDUE MG C 9043
096FC6SOFTWAREGLU C:1051 , VAL C:1076 , HOH C:9490 , SER D:752BINDING SITE FOR RESIDUE MG C 9044
097FC7SOFTWAREASP C:714 , HOH C:2145 , HOH C:9903BINDING SITE FOR RESIDUE MG C 9049
098FC8SOFTWAREHOH C:2068BINDING SITE FOR RESIDUE MG C 9050
099FC9SOFTWAREPRO C:794 , ALA C:1025 , HOH D:9961BINDING SITE FOR RESIDUE MG C 9051
100FD1SOFTWAREARG L:30 , ASP L:191BINDING SITE FOR RESIDUE MG L 9408
101FD2SOFTWAREHOH K:3020 , MG L:9260BINDING SITE FOR RESIDUE MG L 9409
102FD3SOFTWAREHOH L:2254BINDING SITE FOR RESIDUE MG L 9446
103FD4SOFTWARETYR L:57BINDING SITE FOR RESIDUE MG L 9450
104FD5SOFTWAREPHE K:179 , ASP M:937 , ARG M:939 , TYR M:975 , GLY M:980BINDING SITE FOR RESIDUE MG M 9159
105FD6SOFTWAREARG M:468 , HOH M:2015 , HOH M:9700BINDING SITE FOR RESIDUE MG M 9167
106FD7SOFTWAREHIS M:1006 , PHE M:1027 , GLY M:1028BINDING SITE FOR RESIDUE MG M 9169
107FD8SOFTWAREGLU M:1061 , GLU M:1078 , SER M:1080 , HOH M:2175BINDING SITE FOR RESIDUE MG M 9170
108FD9SOFTWAREGLU M:585 , ARG M:589 , TYR M:596 , HOH M:9699BINDING SITE FOR RESIDUE MG M 9172
109GC1SOFTWAREASP C:863 , TYR C:925BINDING SITE FOR RESIDUE MG C 9063
110GC2SOFTWAREPRO C:318 , HOH P:9553 , HOH P:9684BINDING SITE FOR RESIDUE MG C 9064
111GC3SOFTWARELEU C:571 , GLY C:669 , GLN C:670 , TYR C:700 , ILE C:994BINDING SITE FOR RESIDUE MG C 9070
112GC4SOFTWAREILE C:163 , LEU C:165 , HOH C:9657 , HOH C:9830 , HOH C:9972BINDING SITE FOR RESIDUE MG C 9074
113GC5SOFTWAREHIS C:889 , ILE C:914 , LYS C:915 , LEU C:968BINDING SITE FOR RESIDUE MG C 9078
114GC6SOFTWAREHOH B:9520 , TYR C:682 , LYS C:851 , GLN D:636BINDING SITE FOR RESIDUE MG C 9084
115GC7SOFTWARELEU C:413 , HOH C:9691 , HOH C:9744BINDING SITE FOR RESIDUE MG C 9093
116GC8SOFTWAREHOH C:2158 , HOH C:9819 , HOH D:2354 , HOH D:9561BINDING SITE FOR RESIDUE MG C 9094
117GC9SOFTWAREPHE C:239 , ASP C:246BINDING SITE FOR RESIDUE MG C 9100
118GD1SOFTWAREILE M:523 , HOH M:2099 , HOH M:9749BINDING SITE FOR RESIDUE MG M 9173
119GD2SOFTWAREGLY M:212 , GLY M:215 , GLU M:216 , VAL M:218BINDING SITE FOR RESIDUE MG M 9180
120GD3SOFTWARELEU M:285 , SER M:286 , LEU M:290 , ALA M:291 , LYS M:299BINDING SITE FOR RESIDUE MG M 9183
121GD4SOFTWAREARG M:627BINDING SITE FOR RESIDUE MG M 9189
122GD5SOFTWAREGLY M:927 , LYS M:928 , HOH M:2001 , MG M:9443BINDING SITE FOR RESIDUE MG M 9191
123GD6SOFTWAREHIS M:552 , ALA M:909 , HOH M:9916BINDING SITE FOR RESIDUE MG M 9192
124GD7SOFTWARELEU M:260 , ILE M:261BINDING SITE FOR RESIDUE MG M 9196
125GD8SOFTWAREASN M:563 , THR M:566 , GLN M:567 , HOH M:2027 , HOH M:2185BINDING SITE FOR RESIDUE MG M 9202
126GD9SOFTWAREARG M:808 , HOH M:2275 , HOH M:9511BINDING SITE FOR RESIDUE MG M 9214
127HC1SOFTWAREHOH C:9826BINDING SITE FOR RESIDUE MG C 9102
128HC2SOFTWAREHOH C:9755BINDING SITE FOR RESIDUE MG C 9105
129HC3SOFTWAREGLU C:177 , HOH C:9860 , HOH N:2059BINDING SITE FOR RESIDUE MG C 9107
130HC4SOFTWAREMG C:9316 , HOH C:9980BINDING SITE FOR RESIDUE MG C 9112
131HC5SOFTWAREILE C:9 , ARG C:10 , ARG C:472 , HOH C:9549BINDING SITE FOR RESIDUE MG C 9123
132HC6SOFTWAREVAL C:441 , ALA C:555 , ASN C:556 , MG C:9357 , ALA D:1077BINDING SITE FOR RESIDUE MG C 9124
133HC7SOFTWAREGLU C:216 , VAL C:218 , GLN C:219BINDING SITE FOR RESIDUE MG C 9136
134HC8SOFTWAREGLU C:1036BINDING SITE FOR RESIDUE MG C 9138
135HC9SOFTWAREASP C:326 , ASP C:426 , ASP C:429BINDING SITE FOR RESIDUE MG C 9142
136HD1SOFTWAREGLU M:37 , HOH M:9707BINDING SITE FOR RESIDUE MG M 9216
137HD2SOFTWAREALA M:1045 , ALA M:1046 , LEU M:1049 , ILE N:1472BINDING SITE FOR RESIDUE MG M 9218
138HD3SOFTWAREILE M:3 , ARG M:5 , HOH M:2134BINDING SITE FOR RESIDUE MG M 9225
139HD4SOFTWARETRP M:1038 , HOH M:2165 , LYS N:1463 , MG N:9224BINDING SITE FOR RESIDUE MG M 9226
140HD5SOFTWAREARG M:648BINDING SITE FOR RESIDUE MG M 9229
141HD6SOFTWAREGLU M:1091 , HOH M:2025 , HOH M:9705 , HOH M:9927BINDING SITE FOR RESIDUE MG M 9230
142HD7SOFTWAREPHE M:239 , HOH M:2102BINDING SITE FOR RESIDUE MG M 9232
143HD8SOFTWAREGLN M:390 , LEU M:413 , HOH P:9655BINDING SITE FOR RESIDUE MG M 9234
144HD9SOFTWARETYR M:202 , LEU M:304 , HOH M:9745BINDING SITE FOR RESIDUE MG M 9237
145IC1SOFTWAREVAL C:474 , GLY C:476 , HOH C:2211 , HOH C:9625 , HIS P:263BINDING SITE FOR RESIDUE MG C 9145
146IC2SOFTWAREGLU C:210 , HOH C:2001BINDING SITE FOR RESIDUE MG C 9146
147IC3SOFTWARELYS C:4 , HOH C:9575 , HOH C:9926 , HOH C:9977BINDING SITE FOR RESIDUE MG C 9315
148IC4SOFTWAREMG C:9112BINDING SITE FOR RESIDUE MG C 9316
149IC5SOFTWAREHOH C:9882 , HOH C:9902BINDING SITE FOR RESIDUE MG C 9317
150IC6SOFTWAREMET C:1 , MG C:9025 , HOH C:9870BINDING SITE FOR RESIDUE MG C 9321
151IC7SOFTWAREHOH C:9777BINDING SITE FOR RESIDUE MG C 9322
152IC8SOFTWAREHOH C:9975BINDING SITE FOR RESIDUE MG C 9332
153IC9SOFTWAREHOH C:9601BINDING SITE FOR RESIDUE MG C 9333
154ID1SOFTWARELEU M:328 , ARG M:331 , PHE M:466 , ILE M:467BINDING SITE FOR RESIDUE MG M 9242
155ID2SOFTWAREHOH M:9766 , HOH M:9779BINDING SITE FOR RESIDUE MG M 9244
156ID3SOFTWAREARG M:432 , HOH M:2166 , HOH M:9836BINDING SITE FOR RESIDUE MG M 9245
157ID4SOFTWAREHIS M:102 , GLU M:364 , ASP M:365 , LEU M:367 , HOH M:2142BINDING SITE FOR RESIDUE MG M 9246
158ID5SOFTWARETHR M:723 , HOH M:9659 , HOH M:9760 , HOH M:9788BINDING SITE FOR RESIDUE MG M 9247
159ID6SOFTWAREARG M:507 , HOH M:9942BINDING SITE FOR RESIDUE MG M 9251
160ID7SOFTWARELYS M:957BINDING SITE FOR RESIDUE MG M 9253
161ID8SOFTWAREGLU M:720 , ARG M:758BINDING SITE FOR RESIDUE MG M 9255
162ID9SOFTWAREGLU M:913BINDING SITE FOR RESIDUE MG M 9261
163JC1SOFTWAREHOH C:2045BINDING SITE FOR RESIDUE MG C 9334
164JC2SOFTWARELEU C:15 , LEU C:583BINDING SITE FOR RESIDUE MG C 9335
165JC3SOFTWAREHOH C:9761BINDING SITE FOR RESIDUE MG C 9339
166JC4SOFTWAREALA C:782 , ARG C:783 , HOH C:2013BINDING SITE FOR RESIDUE MG C 9340
167JC5SOFTWAREVAL C:12 , ILE C:13 , ASP C:481BINDING SITE FOR RESIDUE MG C 9345
168JC6SOFTWAREGLU C:175 , LYS C:185 , HOH C:2318BINDING SITE FOR RESIDUE MG C 9346
169JC7SOFTWAREHOH C:2015 , HOH C:9937BINDING SITE FOR RESIDUE MG C 9347
170JC8SOFTWAREASN C:556 , MG C:9124 , HOH C:9756 , HOH C:9847 , ALA D:1077BINDING SITE FOR RESIDUE MG C 9357
171JC9SOFTWAREGLN C:899BINDING SITE FOR RESIDUE MG C 9359
172JD1SOFTWAREARG M:650 , HOH M:9739BINDING SITE FOR RESIDUE MG M 9264
173JD2SOFTWARELEU M:1102 , ASP M:1106 , ASN M:1107BINDING SITE FOR RESIDUE MG M 9267
174JD3SOFTWAREASN M:41 , GLN M:45 , ARG M:49BINDING SITE FOR RESIDUE MG M 9272
175JD4SOFTWAREMG M:9439 , HOH M:9708BINDING SITE FOR RESIDUE MG M 9275
176JD5SOFTWAREASP M:1106BINDING SITE FOR RESIDUE MG M 9292
177JD6SOFTWAREPRO M:400 , PRO M:659BINDING SITE FOR RESIDUE MG M 9297
178JD7SOFTWAREASN M:1107 , HOH M:9775BINDING SITE FOR RESIDUE MG M 9301
179JD8SOFTWARELYS M:930 , GLY M:931 , MG M:9394BINDING SITE FOR RESIDUE MG M 9302
180JD9SOFTWAREASP M:223 , HOH M:9787BINDING SITE FOR RESIDUE MG M 9306
181KC1SOFTWAREHOH C:2007 , HOH C:9965BINDING SITE FOR RESIDUE MG C 9413
182KC2SOFTWAREHOH C:2153 , HOH C:2202 , HOH C:9500BINDING SITE FOR RESIDUE MG C 9419
183KC3SOFTWAREASP C:268BINDING SITE FOR RESIDUE MG C 9422
184KC4SOFTWAREARG C:978 , THR D:940BINDING SITE FOR RESIDUE MG C 9435
185KC5SOFTWAREHOH C:2190 , HOH C:2325BINDING SITE FOR RESIDUE MG C 9452
186KC6SOFTWAREGLN C:204 , MET C:222BINDING SITE FOR RESIDUE MG C 9453
187KC7SOFTWARELYS C:781 , HOH C:2066BINDING SITE FOR RESIDUE MG C 9459
188KC8SOFTWAREHOH C:2147BINDING SITE FOR RESIDUE MG C 9476
189KC9SOFTWAREASN C:187BINDING SITE FOR RESIDUE MG C 9478
190KD1SOFTWAREHOH M:2305 , MG M:9372 , MG M:9438BINDING SITE FOR RESIDUE MG M 9367
191KD2SOFTWAREPHE F:233 , LYS F:234BINDING SITE FOR RESIDUE MG M 9370
192KD3SOFTWAREHOH M:2004 , MG M:9367 , MG M:9438 , HOH M:9603BINDING SITE FOR RESIDUE MG M 9372
193KD4SOFTWAREARG M:808 , ARG M:820 , HOH M:9837BINDING SITE FOR RESIDUE MG M 9374
194KD5SOFTWAREASP M:590BINDING SITE FOR RESIDUE MG M 9383
195KD6SOFTWAREARG M:573BINDING SITE FOR RESIDUE MG M 9388
196KD7SOFTWAREGLU M:599 , HOH M:2119 , HOH M:9923BINDING SITE FOR RESIDUE MG M 9392
197KD8SOFTWAREGLY M:931 , HOH M:2057 , MG M:9302 , MG M:9443 , HOH M:9835BINDING SITE FOR RESIDUE MG M 9394
198KD9SOFTWAREGLU M:445 , HOH M:9829 , HOH M:9951BINDING SITE FOR RESIDUE MG M 9399
199LC1SOFTWARECYS D:58 , CYS D:60 , CYS D:73BINDING SITE FOR RESIDUE PB D 6058
200LC2SOFTWARECYS D:1112 , CYS D:1194 , THR D:1196 , CYS D:1201 , CYS D:1204BINDING SITE FOR RESIDUE PB D 6112
201LC3SOFTWAREASP D:739 , ASP D:741 , ASP D:743 , HOH D:9503BINDING SITE FOR RESIDUE MG D 8001
202LC4SOFTWAREARG D:613 , GLN D:616 , HOH D:9748 , PHE F:328BINDING SITE FOR RESIDUE MG D 9002
203LC5SOFTWAREMET D:1045 , HOH D:2038 , HOH D:2407BINDING SITE FOR RESIDUE MG D 9003
204LC6SOFTWAREHOH D:2575 , GLU P:225 , HOH P:9672BINDING SITE FOR RESIDUE MG D 9005
205LC7SOFTWAREPRO D:1125 , GLU D:1127 , VAL D:1128 , HOH D:2519 , HOH D:9645BINDING SITE FOR RESIDUE MG D 9008
206LC8SOFTWAREALA D:96 , THR D:97 , LEU D:554 , LYS D:571 , LEU D:574BINDING SITE FOR RESIDUE MG D 9017
207LC9SOFTWAREGLU D:1405 , ARG D:1406 , ALA D:1409 , GLU D:1410 , GLY D:1411 , MG D:9022 , HOH D:9962BINDING SITE FOR RESIDUE MG D 9019
208LD1SOFTWARESER M:730BINDING SITE FOR RESIDUE MG M 9405
209LD2SOFTWAREHOH M:2305 , MG M:9367 , MG M:9372BINDING SITE FOR RESIDUE MG M 9438
210LD3SOFTWAREMG M:9275 , HOH M:9708 , HOH M:9975BINDING SITE FOR RESIDUE MG M 9439
211LD4SOFTWAREMG M:9191 , MG M:9394 , HOH M:9990BINDING SITE FOR RESIDUE MG M 9443
212LD5SOFTWAREHOH M:2009BINDING SITE FOR RESIDUE MG M 9444
213LD6SOFTWAREGLU M:1078BINDING SITE FOR RESIDUE MG M 9465
214LD7SOFTWAREGLU M:1068 , ALA M:1069 , GLU M:1074BINDING SITE FOR RESIDUE MG M 9481
215LD8SOFTWARECYS N:58 , CYS N:60 , CYS N:73 , CYS N:76BINDING SITE FOR RESIDUE PB N 7058
216LD9SOFTWARECYS N:1112 , CYS N:1194 , GLN N:1195 , CYS N:1204 , MG N:9257 , MG N:9396BINDING SITE FOR RESIDUE PB N 7112
217MC1SOFTWAREGLU D:776 , ASP D:913 , TYR D:916 , HOH D:2062 , HOH D:2187BINDING SITE FOR RESIDUE MG D 9020
218MC2SOFTWAREALA D:1024 , HOH D:9747 , HOH D:9856BINDING SITE FOR RESIDUE MG D 9021
219MC3SOFTWAREARG D:1406 , HOH D:2220 , HOH D:2362 , MG D:9019BINDING SITE FOR RESIDUE MG D 9022
220MC4SOFTWAREMG P:9295BINDING SITE FOR RESIDUE MG D 9024
221MC5SOFTWAREHIS D:709 , ALA D:735 , ASN D:737BINDING SITE FOR RESIDUE MG D 9026
222MC6SOFTWAREALA D:1249 , HOH D:9919BINDING SITE FOR RESIDUE MG D 9027
223MC7SOFTWAREHOH C:9695 , HOH D:2264 , HOH D:2625BINDING SITE FOR RESIDUE MG D 9028
224MC8SOFTWAREILE D:32 , LEU D:37 , MET D:527 , HOH D:2033BINDING SITE FOR RESIDUE MG D 9031
225MC9SOFTWAREGLU D:1342 , HOH D:2170 , MG D:9153BINDING SITE FOR RESIDUE MG D 9032
226MD1SOFTWAREASP N:739 , ASP N:743 , MG N:8003BINDING SITE FOR RESIDUE MG N 8002
227MD2SOFTWAREASP N:739 , ASP N:741 , ASP N:743 , MG N:8002 , HOH N:9779BINDING SITE FOR RESIDUE MG N 8003
228MD3SOFTWAREGLU N:214 , TYR N:215 , VAL N:216BINDING SITE FOR RESIDUE MG N 9160
229MD4SOFTWAREPHE N:68 , VAL N:80 , HOH N:2117 , HOH N:9746BINDING SITE FOR RESIDUE MG N 9161
230MD5SOFTWARETHR N:1196 , ARG N:1197 , TYR N:1198 , GLY N:1199 , HOH N:9809BINDING SITE FOR RESIDUE MG N 9162
231MD6SOFTWAREPRO N:15 , ILE N:513 , LEU N:514 , GLU N:515 , ALA N:516BINDING SITE FOR RESIDUE MG N 9164
232MD7SOFTWARETHR N:1115 , MG N:9407 , HOH N:9975BINDING SITE FOR RESIDUE MG N 9171
233MD8SOFTWAREMET N:1045 , GLN N:1046 , GLY N:1076 , HOH N:9780 , HOH N:9803BINDING SITE FOR RESIDUE MG N 9175
234MD9SOFTWAREGLU N:234 , GLU N:240 , HOH N:9724BINDING SITE FOR RESIDUE MG N 9177
235NC1SOFTWAREGLU D:474 , ARG D:500BINDING SITE FOR RESIDUE MG D 9033
236NC2SOFTWAREHOH D:2321 , HOH D:9792BINDING SITE FOR RESIDUE MG D 9034
237NC3SOFTWAREGLU D:893BINDING SITE FOR RESIDUE MG D 9035
238NC4SOFTWARELYS D:800 , LEU D:804 , VAL D:829 , ALA D:830 , HOH D:2626 , HOH D:9895BINDING SITE FOR RESIDUE MG D 9037
239NC5SOFTWARELYS D:218 , GLU D:219 , ALA D:369 , ALA D:370BINDING SITE FOR RESIDUE MG D 9039
240NC6SOFTWAREASP D:1169 , HOH D:2274 , HOH D:9738BINDING SITE FOR RESIDUE MG D 9042
241NC7SOFTWAREGLU D:1391 , GLY D:1392BINDING SITE FOR RESIDUE MG D 9046
242NC8SOFTWAREGLY D:139 , ALA D:140 , TYR D:450 , ASP D:451 , HOH D:9910BINDING SITE FOR RESIDUE MG D 9048
243NC9SOFTWAREARG D:224 , LEU D:225 , HOH D:2259 , HOH D:9751 , HOH D:9835BINDING SITE FOR RESIDUE MG D 9053
244ND1SOFTWAREALA N:1358 , HOH N:2462 , HOH N:9580 , HOH N:9800BINDING SITE FOR RESIDUE MG N 9179
245ND2SOFTWARELYS N:960 , HOH N:9486 , HOH N:9750BINDING SITE FOR RESIDUE MG N 9181
246ND3SOFTWARETHR N:944BINDING SITE FOR RESIDUE MG N 9182
247ND4SOFTWAREGLY N:506 , ASN N:507 , ARG N:508 , HOH N:9869 , HOH N:9972BINDING SITE FOR RESIDUE MG N 9184
248ND5SOFTWARESER N:410 , ASP N:413 , VAL N:420BINDING SITE FOR RESIDUE MG N 9185
249ND6SOFTWAREHIS N:1242 , HOH N:9830BINDING SITE FOR RESIDUE MG N 9186
250ND7SOFTWAREGLN N:714 , VAL N:732 , ALA N:735 , HOH N:9711 , HOH N:9907BINDING SITE FOR RESIDUE MG N 9188
251ND8SOFTWAREARG N:1213 , SER N:1216 , HOH O:2185 , HOH O:2282 , MG O:9168BINDING SITE FOR RESIDUE MG N 9190
252ND9SOFTWAREGLU L:154 , HOH L:1035 , HOH L:2107 , MG L:9222 , LEU N:839 , LYS N:840BINDING SITE FOR RESIDUE MG N 9195
253OC1SOFTWAREHOH D:9737 , HOH D:9951BINDING SITE FOR RESIDUE MG D 9054
254OC2SOFTWAREALA D:766 , HIS D:767 , ALA E:2BINDING SITE FOR RESIDUE MG D 9055
255OC3SOFTWARELEU D:227BINDING SITE FOR RESIDUE MG D 9056
256OC4SOFTWARELEU D:920 , MG D:9324 , HOH D:9950BINDING SITE FOR RESIDUE MG D 9057
257OC5SOFTWARETHR D:411 , ASP D:430 , HOH D:2334BINDING SITE FOR RESIDUE MG D 9058
258OC6SOFTWARETYR D:163 , HOH D:2510BINDING SITE FOR RESIDUE MG D 9059
259OC7SOFTWAREARG D:41 , HOH D:2025BINDING SITE FOR RESIDUE MG D 9065
260OC8SOFTWARESER D:771 , PRO D:772 , ASP D:1208BINDING SITE FOR RESIDUE MG D 9067
261OC9SOFTWAREILE D:606 , LEU D:607 , HOH D:2415BINDING SITE FOR RESIDUE MG D 9068
262OD1SOFTWAREVAL N:1381 , THR N:1382 , LEU N:1389 , HOH N:9767BINDING SITE FOR RESIDUE MG N 9199
263OD2SOFTWAREASN N:569 , PRO P:80 , TYR P:84BINDING SITE FOR RESIDUE MG N 9200
264OD3SOFTWAREGLY N:1157BINDING SITE FOR RESIDUE MG N 9205
265OD4SOFTWARELYS N:1362 , MG N:9281 , HOH N:9923 , HOH N:9961BINDING SITE FOR RESIDUE MG N 9207
266OD5SOFTWAREASP N:1100 , HIS N:1103 , SER N:1436 , PHE N:1440 , LYS N:1463BINDING SITE FOR RESIDUE MG N 9208
267OD6SOFTWAREARG N:399 , ASP N:430 , TYR N:432 , HOH N:2144 , HOH N:9964BINDING SITE FOR RESIDUE MG N 9211
268OD7SOFTWAREVAL N:591BINDING SITE FOR RESIDUE MG N 9212
269OD8SOFTWAREASP N:504 , ASP N:1386BINDING SITE FOR RESIDUE MG N 9213
270OD9SOFTWAREPRO N:246 , GLU N:247BINDING SITE FOR RESIDUE MG N 9215
271PC1SOFTWAREPRO D:208 , ARG D:209BINDING SITE FOR RESIDUE MG D 9075
272PC2SOFTWAREGLU D:734 , LYS D:780BINDING SITE FOR RESIDUE MG D 9077
273PC3SOFTWARETYR D:1165 , PRO D:1214 , HOH D:2471 , HOH D:9855 , HOH D:9890BINDING SITE FOR RESIDUE MG D 9079
274PC4SOFTWARELEU D:1336 , GLU D:1337BINDING SITE FOR RESIDUE MG D 9080
275PC5SOFTWAREPRO P:167 , LYS P:168 , MG P:9288BINDING SITE FOR RESIDUE MG D 9081
276PC6SOFTWAREMG D:9313BINDING SITE FOR RESIDUE MG D 9083
277PC7SOFTWAREARG A:112 , GLU D:1154 , MG D:9318BINDING SITE FOR RESIDUE MG D 9087
278PC8SOFTWAREGLY D:1248 , ALA D:1249BINDING SITE FOR RESIDUE MG D 9090
279PC9SOFTWAREHOH D:2288 , HOH D:2314 , HOH D:2398 , HOH D:9943BINDING SITE FOR RESIDUE MG D 9095
280PD1SOFTWAREPRO M:440 , HOH M:9785 , ARG N:1078BINDING SITE FOR RESIDUE MG N 9217
281PD2SOFTWAREGLN D:976 , LYS N:28BINDING SITE FOR RESIDUE MG N 9220
282PD3SOFTWAREMG M:9226BINDING SITE FOR RESIDUE MG N 9224
283PD4SOFTWARELYS N:475BINDING SITE FOR RESIDUE MG N 9228
284PD5SOFTWARELYS N:1314 , ASP N:1315 , GLY N:1316 , ASP N:1317BINDING SITE FOR RESIDUE MG N 9231
285PD6SOFTWARETYR N:936 , HOH N:9787BINDING SITE FOR RESIDUE MG N 9238
286PD7SOFTWARELEU N:439 , VAL N:440 , ARG N:441 , ASN N:442BINDING SITE FOR RESIDUE MG N 9241
287PD8SOFTWAREHOH N:2213 , HOH N:9590BINDING SITE FOR RESIDUE MG N 9243
288PD9SOFTWAREPRO N:208 , ARG N:209BINDING SITE FOR RESIDUE MG N 9248
289QC1SOFTWAREALA D:849 , PRO D:877BINDING SITE FOR RESIDUE MG D 9096
290QC2SOFTWAREARG D:399 , HOH D:2109 , HOH D:9544BINDING SITE FOR RESIDUE MG D 9097
291QC3SOFTWAREMG D:9353BINDING SITE FOR RESIDUE MG D 9101
292QC4SOFTWAREHOH D:2017 , HOH D:9960BINDING SITE FOR RESIDUE MG D 9103
293QC5SOFTWAREGLN C:1019 , GLN D:616 , GLY D:620 , HOH F:9488BINDING SITE FOR RESIDUE MG D 9104
294QC6SOFTWAREMET D:980 , LYS N:556 , GLN N:560 , GLN P:218BINDING SITE FOR RESIDUE MG D 9108
295QC7SOFTWAREASP D:413 , ASP D:419 , ASN D:442 , HOH D:9978BINDING SITE FOR RESIDUE MG D 9109
296QC8SOFTWAREARG D:1137 , ILE D:1175 , HOH D:9841BINDING SITE FOR RESIDUE MG D 9110
297QC9SOFTWARETYR D:34 , THR D:36 , LEU D:37BINDING SITE FOR RESIDUE MG D 9111
298QD1SOFTWAREASP N:155 , GLU N:156BINDING SITE FOR RESIDUE MG N 9252
299QD2SOFTWAREGLY N:364 , VAL N:440BINDING SITE FOR RESIDUE MG N 9254
300QD3SOFTWAREASN N:1116 , SER N:1190 , THR N:1193 , CYS N:1194 , CYS N:1204 , PB N:7112BINDING SITE FOR RESIDUE MG N 9257
301QD4SOFTWAREGLU N:1297BINDING SITE FOR RESIDUE MG N 9259
302QD5SOFTWARELYS N:638BINDING SITE FOR RESIDUE MG N 9262
303QD6SOFTWARELYS N:664BINDING SITE FOR RESIDUE MG N 9266
304QD7SOFTWAREARG N:1266 , ARG N:1267 , ASP N:1331BINDING SITE FOR RESIDUE MG N 9268
305QD8SOFTWAREARG N:508 , HOH N:9549 , HOH N:9743BINDING SITE FOR RESIDUE MG N 9270
306QD9SOFTWAREHOH F:9569 , LYS N:1314 , ASP N:1315BINDING SITE FOR RESIDUE MG N 9271
307RC1SOFTWAREASP D:903BINDING SITE FOR RESIDUE MG D 9113
308RC2SOFTWARESER D:771 , ALA D:773BINDING SITE FOR RESIDUE MG D 9115
309RC3SOFTWAREGLU D:1154 , MG D:9141 , MG D:9318 , MG D:9355BINDING SITE FOR RESIDUE MG D 9117
310RC4SOFTWAREHIS D:386BINDING SITE FOR RESIDUE MG D 9118
311RC5SOFTWARELYS D:217 , LYS D:218 , ASP D:372 , HOH D:9733BINDING SITE FOR RESIDUE MG D 9120
312RC6SOFTWAREGLU D:925 , ALA E:2 , GLU E:3 , PRO E:4 , HOH E:9415BINDING SITE FOR RESIDUE MG D 9121
313RC7SOFTWARELYS D:638 , HOH D:2445BINDING SITE FOR RESIDUE MG D 9122
314RC8SOFTWAREGLU D:1154BINDING SITE FOR RESIDUE MG D 9125
315RC9SOFTWAREGLU D:515 , HOH D:2146 , HOH D:9851BINDING SITE FOR RESIDUE MG D 9126
316RD1SOFTWAREILE B:162 , HOH B:9496 , LYS N:138BINDING SITE FOR RESIDUE MG N 9273
317RD2SOFTWARESER N:83 , ILE N:84 , ASP N:523BINDING SITE FOR RESIDUE MG N 9276
318RD3SOFTWAREPRO F:145 , GLY F:146 , HOH F:9512 , HOH F:9558BINDING SITE FOR RESIDUE MG N 9277
319RD4SOFTWAREGLU N:4 , ARG N:6 , ARG N:1470BINDING SITE FOR RESIDUE MG N 9278
320RD5SOFTWAREGLY N:1245 , ALA N:1247BINDING SITE FOR RESIDUE MG N 9279
321RD6SOFTWAREALA N:1142 , LYS N:1362 , LEU N:1363 , HIS N:1364 , MG N:9207 , HOH N:9923BINDING SITE FOR RESIDUE MG N 9281
322RD7SOFTWAREHIS N:1333 , GLY N:1423 , LYS N:1426BINDING SITE FOR RESIDUE MG N 9282
323RD8SOFTWARELYS N:149 , MG N:9449BINDING SITE FOR RESIDUE MG N 9286
324RD9SOFTWAREHOH N:9940BINDING SITE FOR RESIDUE MG N 9287
325SC1SOFTWAREGLN D:1393BINDING SITE FOR RESIDUE MG D 9127
326SC2SOFTWAREHOH F:9820BINDING SITE FOR RESIDUE MG D 9128
327SC3SOFTWAREGLN D:962 , GLU D:966BINDING SITE FOR RESIDUE MG D 9129
328SC4SOFTWARELYS D:1301 , HOH D:9702 , HOH D:9928BINDING SITE FOR RESIDUE MG D 9132
329SC5SOFTWAREGLU D:1504 , HOH D:9870BINDING SITE FOR RESIDUE MG D 9134
330SC6SOFTWAREHOH D:2091BINDING SITE FOR RESIDUE MG D 9135
331SC7SOFTWAREHOH D:9837BINDING SITE FOR RESIDUE MG D 9139
332SC8SOFTWAREGLU D:1152 , MG D:9117 , MG D:9318BINDING SITE FOR RESIDUE MG D 9141
333SC9SOFTWAREVAL D:1153 , HOH D:9830 , HOH D:9911BINDING SITE FOR RESIDUE MG D 9143
334SD1SOFTWAREARG N:1159 , GLU N:1161 , MG N:9368BINDING SITE FOR RESIDUE MG N 9289
335SD2SOFTWARESER N:1430 , THR N:1431BINDING SITE FOR RESIDUE MG N 9291
336SD3SOFTWARECYS N:1194 , ARG N:1373 , HOH N:2070BINDING SITE FOR RESIDUE MG N 9298
337SD4SOFTWAREHOH F:9662 , HOH F:9758BINDING SITE FOR RESIDUE MG N 9300
338SD5SOFTWAREARG N:198 , MG N:9397BINDING SITE FOR RESIDUE MG N 9303
339SD6SOFTWAREGLY N:595 , HOH N:9940BINDING SITE FOR RESIDUE MG N 9307
340SD7SOFTWAREHOH D:9953 , HOH N:9510BINDING SITE FOR RESIDUE MG N 9366
341SD8SOFTWAREMG N:9289BINDING SITE FOR RESIDUE MG N 9368
342SD9SOFTWAREGLU N:907BINDING SITE FOR RESIDUE MG N 9371
343TC1SOFTWAREASP D:542 , THR D:592BINDING SITE FOR RESIDUE MG D 9147
344TC2SOFTWAREGLY D:1360 , LYS D:1362BINDING SITE FOR RESIDUE MG D 9148
345TC3SOFTWAREGLN D:1195BINDING SITE FOR RESIDUE MG D 9149
346TC4SOFTWAREGLU D:1297 , HOH D:2119 , HOH P:9631BINDING SITE FOR RESIDUE MG D 9150
347TC5SOFTWAREHOH D:9699BINDING SITE FOR RESIDUE MG D 9151
348TC6SOFTWAREHOH D:2486 , MG D:9032BINDING SITE FOR RESIDUE MG D 9153
349TC7SOFTWAREHOH D:2063 , GLU N:25 , GLU N:27 , LYS N:555BINDING SITE FOR RESIDUE MG D 9156
350TC8SOFTWAREALA D:807 , GLU D:833 , HOH D:2205 , HOH D:2285BINDING SITE FOR RESIDUE MG D 9157
351TC9SOFTWAREHOH C:9997 , VAL D:5 , HOH D:2325 , HOH D:9976BINDING SITE FOR RESIDUE MG D 9308
352TD1SOFTWARELEU N:770 , PHE N:919 , SER N:1210 , MET N:1211 , ALA N:1212BINDING SITE FOR RESIDUE MG N 9373
353TD2SOFTWAREGLU N:1405 , ARG N:1406 , ALA N:1409 , GLU N:1410 , HOH N:9481BINDING SITE FOR RESIDUE MG N 9378
354TD3SOFTWAREHIS N:696 , LYS O:47 , LEU O:54 , MG O:9176 , MG O:9203BINDING SITE FOR RESIDUE MG N 9386
355TD4SOFTWARETHR N:1066 , GLU N:1069BINDING SITE FOR RESIDUE MG N 9389
356TD5SOFTWAREGLU N:662 , VAL N:670 , HOH N:9492BINDING SITE FOR RESIDUE MG N 9390
357TD6SOFTWARECYS N:1112 , THR N:1114 , GLN N:1195 , PB N:7112BINDING SITE FOR RESIDUE MG N 9396
358TD7SOFTWAREARG N:198 , MG N:9303BINDING SITE FOR RESIDUE MG N 9397
359TD8SOFTWAREGLN N:991 , LEU N:995BINDING SITE FOR RESIDUE MG N 9398
360TD9SOFTWAREASP N:913 , HOH N:9698BINDING SITE FOR RESIDUE MG N 9406
361UC1SOFTWARELEU D:478 , ARG D:1388BINDING SITE FOR RESIDUE MG D 9312
362UC2SOFTWAREMG D:9083BINDING SITE FOR RESIDUE MG D 9313
363UC3SOFTWAREHOH D:9685BINDING SITE FOR RESIDUE MG D 9314
364UC4SOFTWAREMG D:9087 , MG D:9117 , MG D:9141 , HOH D:9818BINDING SITE FOR RESIDUE MG D 9318
365UC5SOFTWAREHOH D:2046 , HOH D:2097 , HOH D:2412BINDING SITE FOR RESIDUE MG D 9319
366UC6SOFTWARETHR D:1382 , PRO D:1384 , LEU D:1389BINDING SITE FOR RESIDUE MG D 9320
367UC7SOFTWAREGLU D:1501 , ALA D:1502 , VAL D:1503 , GLU D:1504 , HOH D:2252BINDING SITE FOR RESIDUE MG D 9323
368UC8SOFTWARELEU D:920 , MG D:9057 , HOH D:9950 , HOH D:9959BINDING SITE FOR RESIDUE MG D 9324
369UC9SOFTWAREVAL D:1128 , THR D:1129 , ARG D:1130 , SER D:1131BINDING SITE FOR RESIDUE MG D 9327
370UD1SOFTWARETHR N:1114 , THR N:1115 , MG N:9171 , HOH N:9975BINDING SITE FOR RESIDUE MG N 9407
371UD2SOFTWAREARG N:534BINDING SITE FOR RESIDUE MG N 9410
372UD3SOFTWAREARG N:929 , HOH N:2373BINDING SITE FOR RESIDUE MG N 9447
373UD4SOFTWAREMG N:9286BINDING SITE FOR RESIDUE MG N 9449
374UD5SOFTWAREILE N:32 , LEU N:37 , MET N:527 , HOH N:2101BINDING SITE FOR RESIDUE MG N 9468
375UD6SOFTWAREHOH N:2228 , HOH N:2272BINDING SITE FOR RESIDUE MG N 9479
376UD7SOFTWAREHOH N:2237BINDING SITE FOR RESIDUE MG N 9480
377UD8SOFTWAREMG N:9190 , VAL O:13 , HOH O:1891 , HOH O:2164 , HOH O:2185 , HOH O:2282 , HOH O:5026BINDING SITE FOR RESIDUE MG O 9168
378UD9SOFTWAREHIS N:696 , MG N:9386 , LEU O:54 , ASN O:59 , THR O:62 , MG O:9203BINDING SITE FOR RESIDUE MG O 9176
379VC1SOFTWAREPRO D:39 , GLU D:40BINDING SITE FOR RESIDUE MG D 9331
380VC2SOFTWAREMG D:9101BINDING SITE FOR RESIDUE MG D 9353
381VC3SOFTWAREGLU D:1154 , HOH D:2049 , MG D:9117 , HOH D:9818BINDING SITE FOR RESIDUE MG D 9355
382VC4SOFTWARELYS D:1203BINDING SITE FOR RESIDUE MG D 9360
383VC5SOFTWAREHOH D:2246BINDING SITE FOR RESIDUE MG D 9363
384VC6SOFTWAREGLN D:1441 , MG D:9420BINDING SITE FOR RESIDUE MG D 9365
385VC7SOFTWAREGLU D:232 , HOH D:2425BINDING SITE FOR RESIDUE MG D 9411
386VC8SOFTWAREHOH D:9806BINDING SITE FOR RESIDUE MG D 9412
387VC9SOFTWAREGLY D:418 , HOH D:2179 , HOH D:9542BINDING SITE FOR RESIDUE MG D 9414
388VD1SOFTWAREHIS N:696 , MG N:9386 , THR O:62 , MG O:9176BINDING SITE FOR RESIDUE MG O 9203
389VD2SOFTWARELYS O:47 , MET O:48 , GLN O:49BINDING SITE FOR RESIDUE MG O 9210
390VD3SOFTWAREARG O:91 , HOH O:3476BINDING SITE FOR RESIDUE MG O 9274
391VD4SOFTWAREGLU O:96 , HOH O:3434BINDING SITE FOR RESIDUE MG O 9380
392VD5SOFTWAREARG P:128BINDING SITE FOR RESIDUE MG P 9163
393VD6SOFTWARELEU P:375 , ILE P:376 , HOH P:9563BINDING SITE FOR RESIDUE MG P 9193
394VD7SOFTWAREHOH D:2317 , HOH P:9513BINDING SITE FOR RESIDUE MG P 9194
395VD8SOFTWAREARG P:205 , HOH P:9548BINDING SITE FOR RESIDUE MG P 9204
396VD9SOFTWAREASP P:343 , GLN P:347 , HOH P:9564BINDING SITE FOR RESIDUE MG P 9206
397WC1SOFTWAREHOH D:9771BINDING SITE FOR RESIDUE MG D 9415
398WC2SOFTWAREHOH D:2316 , MG D:9365BINDING SITE FOR RESIDUE MG D 9420
399WC3SOFTWARELYS D:187BINDING SITE FOR RESIDUE MG D 9423
400WC4SOFTWAREHOH D:2237BINDING SITE FOR RESIDUE MG D 9425
401WC5SOFTWAREGLN D:636 , HOH D:2240 , HOH D:2422BINDING SITE FOR RESIDUE MG D 9426
402WC6SOFTWARELYS P:403BINDING SITE FOR RESIDUE MG D 9428
403WC7SOFTWAREHOH D:9884BINDING SITE FOR RESIDUE MG D 9431
404WC8SOFTWAREHOH D:2381 , HOH D:9713BINDING SITE FOR RESIDUE MG D 9432
405WC9SOFTWAREASP D:1383BINDING SITE FOR RESIDUE MG D 9433
406WD1SOFTWAREVAL P:81 , LEU P:85 , MG P:9382 , HOH P:9593 , HOH P:9599 , HOH P:9649 , HOH P:9720BINDING SITE FOR RESIDUE MG P 9221
407WD2SOFTWARELYS P:270 , ARG P:273 , THR P:274 , GLN P:277BINDING SITE FOR RESIDUE MG P 9223
408WD3SOFTWAREHOH N:2096 , ARG P:142 , PRO P:145 , GLY P:146BINDING SITE FOR RESIDUE MG P 9227
409WD4SOFTWARELEU D:1311 , HOH D:9585 , HOH D:9764 , HIS P:170BINDING SITE FOR RESIDUE MG P 9233
410WD5SOFTWAREILE P:376 , ASP P:377 , HOH P:9528 , HOH P:9661 , HOH P:9689 , HOH P:9739BINDING SITE FOR RESIDUE MG P 9249
411WD6SOFTWAREMG D:9081 , SER P:165 , LEU P:166 , PRO P:167BINDING SITE FOR RESIDUE MG P 9288
412WD7SOFTWAREHOH P:9528BINDING SITE FOR RESIDUE MG P 9294
413WD8SOFTWAREGLN D:994 , MG D:9024 , MG D:9460BINDING SITE FOR RESIDUE MG P 9295
414WD9SOFTWAREHOH A:9570 , LYS P:162BINDING SITE FOR RESIDUE MG P 9305
415XC1SOFTWAREHOH D:2296 , HOH D:2375 , MG D:9454 , HOH P:9642BINDING SITE FOR RESIDUE MG D 9434
416XC2SOFTWAREHOH D:2238BINDING SITE FOR RESIDUE MG D 9436
417XC3SOFTWAREHIS D:386BINDING SITE FOR RESIDUE MG D 9451
418XC4SOFTWAREHOH D:2296 , MG D:9434BINDING SITE FOR RESIDUE MG D 9454
419XC5SOFTWAREHOH D:2027 , HOH D:2376BINDING SITE FOR RESIDUE MG D 9457
420XC6SOFTWAREMG P:9295BINDING SITE FOR RESIDUE MG D 9460
421XC7SOFTWAREHOH D:2301BINDING SITE FOR RESIDUE MG D 9462
422XC8SOFTWAREGLU E:90 , TYR E:93 , HOH E:9369 , HOH E:9383 , HOH E:9405BINDING SITE FOR RESIDUE MG E 9013
423XC9SOFTWARELYS E:36 , HOH E:9385 , HOH E:9389 , HOH E:9416BINDING SITE FOR RESIDUE MG E 9066
424XD1SOFTWAREGLN P:161 , LYS P:164BINDING SITE FOR RESIDUE MG P 9375
425XD2SOFTWAREMG P:9221 , HOH P:9593BINDING SITE FOR RESIDUE MG P 9382
426XD3SOFTWAREMET P:367 , VAL P:368 , LEU P:371 , ARG P:372 , HOH P:9520BINDING SITE FOR RESIDUE MG P 9401
427XD4SOFTWAREARG P:364 , HOH P:9605BINDING SITE FOR RESIDUE MG P 9402
428XD5SOFTWAREHOH D:9886 , GLU P:101 , LYS P:105BINDING SITE FOR RESIDUE MG P 9404
429XD6SOFTWAREHOH P:9691 , HOH P:9715BINDING SITE FOR RESIDUE MG P 9467
430YC1SOFTWAREGLU E:52 , HOH E:9433 , HOH E:9440BINDING SITE FOR RESIDUE MG E 9082
431YC2SOFTWAREHOH E:9380 , HOH E:9438BINDING SITE FOR RESIDUE MG E 9342
432YC3SOFTWAREHOH E:9373BINDING SITE FOR RESIDUE MG E 9350
433YC4SOFTWAREGLU E:44 , HOH E:9417BINDING SITE FOR RESIDUE MG E 9358
434YC5SOFTWAREGLN D:616 , PHE F:328 , HOH F:9658BINDING SITE FOR RESIDUE MG F 9010
435YC6SOFTWAREARG F:232 , HOH M:9828BINDING SITE FOR RESIDUE MG F 9014
436YC7SOFTWAREHIS F:411BINDING SITE FOR RESIDUE MG F 9016
437YC8SOFTWAREGLU F:266 , HOH F:9667BINDING SITE FOR RESIDUE MG F 9023
438YC9SOFTWAREARG F:104 , GLU F:108BINDING SITE FOR RESIDUE MG F 9038
439ZC1SOFTWARELEU N:1311 , ARG N:1327 , HOH N:2141 , HOH N:2142 , HOH N:9881BINDING SITE FOR RESIDUE MG F 9040
440ZC2SOFTWAREGLY F:387 , PHE F:389 , PHE F:390 , HOH F:9495BINDING SITE FOR RESIDUE MG F 9052
441ZC3SOFTWAREASP F:335 , GLU F:336 , LEU F:338BINDING SITE FOR RESIDUE MG F 9062
442ZC4SOFTWAREARG F:372 , GLU F:384 , HOH F:9644 , HOH F:9770BINDING SITE FOR RESIDUE MG F 9069
443ZC5SOFTWAREHOH D:9817 , ARG F:222 , LYS F:226 , TRP F:242BINDING SITE FOR RESIDUE MG F 9071
444ZC6SOFTWAREHOH C:9722 , HOH C:9886 , HOH C:9995 , GLU F:305BINDING SITE FOR RESIDUE MG F 9076
445ZC7SOFTWARESER F:236 , HOH F:9810BINDING SITE FOR RESIDUE MG F 9099
446ZC8SOFTWAREVAL D:420 , ASP F:160 , LYS F:164 , HOH F:9563BINDING SITE FOR RESIDUE MG F 9130
447ZC9SOFTWAREHOH F:9606 , TYR M:494BINDING SITE FOR RESIDUE MG F 9131

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IW7)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Glu A:26 -Pro A:27
2Glu B:26 -Pro B:27
3Leu C:165 -Pro C:166
4Glu K:26 -Pro K:27
5Glu L:26 -Pro L:27
6Leu M:165 -Pro M:166

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IW7)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  2F:384-408
P:384-408
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  2C:836-848
M:836-848
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  1F:384-408
-
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1C:836-848
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SIGMA70_2PS00716 Sigma-70 factors family signature 2.SIGA_THET2382-408
 
  1-
P:384-408
2RNA_POL_BETAPS01166 RNA polymerases beta chain signature.RPOB_THET8836-848
 
  1-
M:836-848

(-) Exons   (0, 0)

(no "Exon" information available for 1IW7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1iw7a1 A:1-49,A:173-229 RNA polymerase alpha    d1iw7a2 A:50-172 RNA polymerase alpha subunit                                                                              d1iw7a1 A:1-49,A:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1iw7A01 A:1-49,A:172-225                         1iw7A02 A:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1iw7A01 A:1-49,A:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeee...........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 A    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1iw7b1 B:1-49,B:173-229 RNA polymerase alpha    d1iw7b2 B:50-172 RNA polymerase alpha subunit                                                                              d1iw7b1 B:1-49,B:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1iw7B01 B:1-49,B:172-225                         1iw7B02 B:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1iw7B01 B:1-49,B:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeee...........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 B    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain C from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d1iw7c_ C: RNA-polymerase beta                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1iw7C0---------1iw7C02 C:16-143,C:324-469,C:535-593  [code=3.90.1100.10, no name defined]                                                      1iw7C03 C:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             1iw7C02 C:16-143,C:324-469,C:535-593  [code=3.90.1100.10, no name defined]                                                                        1iw7C04 C:470-534  [code=2.30.150.10, no name defined]           1iw7C02 C:16-143,C:324-469,C:535-593                       1iw7C05 C:594-658  [code=2.40.50.100, no name defined]           ---------1iw7C01 C:1-6,C:668-700,C:833-9971iw7C06 C:701-832  [code=2.40.50.150, no name defined]                                                                              1iw7C01 C:1-6,C:668-700,C:833-997  [code=2.40.270.10, no name defined]                                                                                               -------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh...........hhhhhhhhhhh.............eee..........hhhhhhhh....ee.....eee.................ee.......ee....eeee.eeeee...ee.............ee...........eeee...eeee.......hhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhh..............................hhhhhhhhh....................hhhhhhhhhhhhh................eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhhhh.ee........................................ee......ee.....ee...ee...............hhhhhh.ee...............eeee....eeee......ee..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh...ee....eeeeee....eeeee...eee.......ee.....ee..ee............eeee...........eeeeeee...........eeeeehhhhhh....eeeeeeeeeeee....................hhhhh....................ee.......hhhhhhhhhhhhh.....ee...........eeeeeeee............eeeeeeeeeeeee......eeee....eeeeeeee...............ee.hhhhh.....hhhhhhhhhhhhhhhhheeee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeeeeeee....................................hhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 C    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain D from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d1iw7d_ D: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee...hhhhhhhheeee.........................................................hhhhhh.eeeeeeeeeeehhhhhh...hhhhhhh....hhhhhhhhhh...ee..................hhhhhhhhhh..eee.......hhhhhhhhhh.........ee.......ee....ee..............hhhhhhhhhhh...hhhhhh......----------------------------------------------------------------------------------------------------------------.............................eee.eee..................................eeeee....eeeee......ee.hhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh....hhhh.eeeeeee.......eee.....eee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh....................hhhhhhhh..hhhhhhh.......eeeeeeee.......ee..hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhh...eeee.....hhh.eeeeee.......eee.hhhhh.........eeeee...hhhhhhhhhhh....................hhhhhhhhhhh...............hhhhhhhhhhhhhh............hhhhhhhee...hhhhhhhhh.........ee.........hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..ee..........ee................hhhhhhhhhh.......ee....ee.........hhhhhhhhhhhh.....ee.hhhhh....eehhhhhh.............hhhhhhhhhh.hhhhhh..................hhhhhhhhhh...............eee.......ee.eee....ee..ee.........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.eeeeee.........eehhhhhhhhhhhhhh.......eeee...hhhhhhhh..hhhhhh...hhhhhhhhhhhh.eeee...hhhhhhh................eeehhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 D    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain E from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d1iw7e_ E: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 1iw7E00 E:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.hhhhhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhhhh....eee......hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1iw7 E    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain F from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1iw7f3 F:74-257 Sigma70                                                                                                                                                                d1iw7f1 F:258-318 Sigma70                                    d1iw7f2 F:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1iw7F02 F:260-313                                     -------------------------1iw7F03 F:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhh...hhhhhhhhhhhhh..ee...ee...eeee.hhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 F   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain F from PDB  Type:PROTEIN  Length:345
 aligned with SIGA_THET2 | Q72L95 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
          SIGA_THET2     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1iw7f3 F:74-257 Sigma70                                                                                                                                                                d1iw7f1 F:258-318 Sigma70                                    d1iw7f2 F:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1iw7F02 F:260-313                                     -------------------------1iw7F03 F:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhh...hhhhhhhhhhhhh..ee...ee...eeee.hhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIGMA70_2  PDB: F:384-408  --------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 F   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain K from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1iw7k1 K:1-49,K:173-229 RNA polymerase alpha    d1iw7k2 K:50-172 RNA polymerase alpha subunit                                                                              d1iw7k1 K:1-49,K:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1iw7K01 K:1-49,K:172-225                         1iw7K02 K:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1iw7K01 K:1-49,K:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee.........eeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeee...........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 K    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain L from PDB  Type:PROTEIN  Length:229
 aligned with RPOA_THETH | Q9Z9H6 from UniProtKB/Swiss-Prot  Length:315

    Alignment length:229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         
          RPOA_THETH      1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
               SCOP domains d1iw7l1 L:1-49,L:173-229 RNA polymerase alpha    d1iw7l2 L:50-172 RNA polymerase alpha subunit                                                                              d1iw7l1 L:1-49,L:173-229 RNA polymerase alpha             SCOP domains
               CATH domains 1iw7L01 L:1-49,L:172-225                         1iw7L02 L:50-171 RNA Polymerase Alpha Subunit; Chain A, domain 2                                                          1iw7L01 L:1-49,L:172-225                              ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee...eee.hhh.....eee.....eeee.....eeeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeee...........eeeeeeeee....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 L    1 MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ  229
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         

Chain M from PDB  Type:PROTEIN  Length:1119
 aligned with RPOB_THET8 | Q8RQE9 from UniProtKB/Swiss-Prot  Length:1119

    Alignment length:1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         
          RPOB_THET8      1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
               SCOP domains d1iw7m_ M: RNA-polymerase beta                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains -1iw7M011iw7M02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                              1iw7M03 M:144-323  [code=3.90.1110.10, no name defined]                                                                                                                             1iw7M02 M:9-143,M:324-470,M:536-592  [code=3.90.1100.10, no name defined]                                                                          1iw7M04 M:471-535  [code=2.30.150.10, no name defined]           1iw7M02 M:9-143,M:324-470,M:536-592                      1iw7M05 M:593-667  [code=2.40.50.100, no name defined]                     1iw7M01                        1iw7M06 M:699-831  [code=2.40.50.150, no name defined]                                                                               1iw7M01 M:2-8,M:668-698,M:832-1004  [code=2.40.270.10, no name defined]                                                                                                      ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.............hhhhhhhhhhhh............hhhhhhhhhh.............eee..........hhhhhhhh....ee.....eee.................ee.......ee....eeee..eeee...ee.............ee...........eeee...eeee.......hhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhh..............................hhhhhhhhh....................hhhhhhhhhhhhh............hhh.eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh...eee....hhhhhhhhhh.ee........................................ee......ee.....ee...ee...............hhhhhh.ee...............eeeee..eeeee......ee..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh...ee....eeeeee....eeeee...eee.......ee.....ee..ee............eeee............eeeeee...........eeeeehhhhhh....eeeeeeeeeeee....................hhhhh...............eee..ee.......hhhhhhhhhhhhh.....ee..ee.......eeeeeeee............eeeeeeeeeeeee......eeee....eeeeeeee...............ee.hhhhh.....hhhhhhhhhhhhhhhhh.eee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh.ee..............eeeeeeeeee....................................hhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNA_POL_BETA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 M    1 MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR 1119
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110         

Chain N from PDB  Type:PROTEIN  Length:1392
 aligned with RPOC_THET8 | Q8RQE8 from UniProtKB/Swiss-Prot  Length:1524

    Alignment length:1504
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
          RPOC_THET8      2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
               SCOP domains d1iw7n_ N: RNA-polymerase beta-prime                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee...hhhhhhhheeee........................................................hhhhhhh.eeeeeeeeeeehhhhhh...hhhhhhh....hhhhhhhhhh...ee..................hhhhhhhhhh..eee.......hhhhhhhhhh.........ee.......ee....ee..............hhhhhhhhhhh...hhhhhh......----------------------------------------------------------------------------------------------------------------.............................eee.eee..................................eeeee....eeeee......ee.hhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh....hhhh.eeeeeee.......eeeee..eeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh....................hhhhhhhh..hhhhhhh.......eeeeeeee.......eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhh...eeee.....hhh.eeeeeeeee....eee.hhhhh.........eeeee...hhhhhhhhhhh....................hhhhhhhhhhh...............hhhhhhhhhhhhhh............hhhhhhhee...hhhhhhhhh.........ee.........hhhhhhhhhhhhhhh.hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..........ee................hhhhhhhhhh.......ee....ee.........hhhhhhhhhhhh.....ee.hhhhh....eehhhhhh.............hhhhhhhhhhhhhhhhh..................hhhhhhhhhh...............eee.......ee.eee....ee..ee.........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.eeeeee.........eehhhhhhhhhhhhhh.......eeeee..hhhhhhhh..hhhhhh...hhhhhhhhhhhh.eeee...hhhhhhh................eeehhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 N    2 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLF----------------------------------------------------------------------------------------------------------------GDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA 1505
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         -         -         -         -         -         -         -         -         -         -         -  |    371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501    
                                                                                                                                                                                                                                                                                   251                                                                                                              364                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain O from PDB  Type:PROTEIN  Length:95
 aligned with RPOZ_THET8 | Q8RQE7 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:95
                                    11        21        31        41        51        61        71        81        91     
          RPOZ_THET8      2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE   96
               SCOP domains d1iw7o_ O: RNA polymerase omega subunit                                                         SCOP domains
               CATH domains 1iw7O00 O:2-96  [code=3.90.940.10, no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.hhhhhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhhhh....eee......hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                1iw7 O    2 AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE   96
                                    11        21        31        41        51        61        71        81        91     

Chain P from PDB  Type:PROTEIN  Length:345
 aligned with Q5SKW1_THET8 | Q5SKW1 from UniProtKB/TrEMBL  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
        Q5SKW1_THET8     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1iw7p3 P:74-257 Sigma70                                                                                                                                                                d1iw7p1 P:258-318 Sigma70                                    d1iw7p2 P:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1iw7P02 P:260-313                                     -------------------------1iw7P03 P:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh........hhhhhhhhh...hhhhhhhhhhhhh..ee...ee...eeee.hhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 P   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

Chain P from PDB  Type:PROTEIN  Length:345
 aligned with SIGA_THET2 | Q72L95 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:350
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
          SIGA_THET2     74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
               SCOP domains d1iw7p3 P:74-257 Sigma70                                                                                                                                                                d1iw7p1 P:258-318 Sigma70                                    d1iw7p2 P:319-423 Sigma70 (SigA, RpoD)                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1iw7P02 P:260-313                                     -------------------------1iw7P03 P:339-420 'winged helix' repress     or DNA binding domain                --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh........hhhhhhhhh...hhhhhhhhhhhhh..ee...ee...eeee.hhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...-----hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIGMA70_2  PDB: P:384-408  --------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1iw7 P   74 KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDG-----EEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD  423
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373    |    -|      393       403       413       423
                                                                                                                                                                                                                                                                                                                                          378   384                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (8, 20)

Asymmetric Unit

(-) CATH Domains  (10, 26)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IW7)

(-) Gene Ontology  (15, 41)

Asymmetric Unit(hide GO term definitions)
Chain A,B,K,L   (RPOA_THETH | Q9Z9H6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain C,M   (RPOB_THET8 | Q8RQE9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0032549    ribonucleoside binding    Interacting selectively and non-covalently with a ribonucleoside, a compound consisting of a purine or pyrimidine nitrogenous base linked to ribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain D,N   (RPOC_THET8 | Q8RQE8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain E,O   (RPOZ_THET8 | Q8RQE7)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain F,P   (Q5SKW1_THET8 | Q5SKW1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016987    sigma factor activity    A sigma factor is the promoter specificity subunit of eubacterial-type multisubunit RNA polymerases, those whose core subunit composition is often described as alpha(2)-beta-beta-prime. (This type of multisubunit RNA polymerase complex is known to be found in eubacteria and plant plastids). Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, this binds specifically to promoter sequences, with the sigma factor making sequence specific contacts with the promoter elements. The sigma subunit is released from the elongating form of the polymerase and is thus free to act catalytically for multiple RNA polymerase core enzymes.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001123    transcription initiation from bacterial-type RNA polymerase promoter    Any process involved in the assembly of bacterial-type RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain F,P   (SIGA_THET2 | Q72L95)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0016987    sigma factor activity    A sigma factor is the promoter specificity subunit of eubacterial-type multisubunit RNA polymerases, those whose core subunit composition is often described as alpha(2)-beta-beta-prime. (This type of multisubunit RNA polymerase complex is known to be found in eubacteria and plant plastids). Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, this binds specifically to promoter sequences, with the sigma factor making sequence specific contacts with the promoter elements. The sigma subunit is released from the elongating form of the polymerase and is thus free to act catalytically for multiple RNA polymerase core enzymes.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001123    transcription initiation from bacterial-type RNA polymerase promoter    Any process involved in the assembly of bacterial-type RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
    CD4  [ RasMol ]  +environment [ RasMol ]
    CD5  [ RasMol ]  +environment [ RasMol ]
    CD6  [ RasMol ]  +environment [ RasMol ]
    CD7  [ RasMol ]  +environment [ RasMol ]
    CD8  [ RasMol ]  +environment [ RasMol ]
    CD9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    DD1  [ RasMol ]  +environment [ RasMol ]
    DD2  [ RasMol ]  +environment [ RasMol ]
    DD3  [ RasMol ]  +environment [ RasMol ]
    DD4  [ RasMol ]  +environment [ RasMol ]
    DD5  [ RasMol ]  +environment [ RasMol ]
    DD6  [ RasMol ]  +environment [ RasMol ]
    DD7  [ RasMol ]  +environment [ RasMol ]
    DD8  [ RasMol ]  +environment [ RasMol ]
    DD9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    ED1  [ RasMol ]  +environment [ RasMol ]
    ED2  [ RasMol ]  +environment [ RasMol ]
    ED3  [ RasMol ]  +environment [ RasMol ]
    ED4  [ RasMol ]  +environment [ RasMol ]
    ED5  [ RasMol ]  +environment [ RasMol ]
    ED6  [ RasMol ]  +environment [ RasMol ]
    ED7  [ RasMol ]  +environment [ RasMol ]
    ED8  [ RasMol ]  +environment [ RasMol ]
    ED9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    FD1  [ RasMol ]  +environment [ RasMol ]
    FD2  [ RasMol ]  +environment [ RasMol ]
    FD3  [ RasMol ]  +environment [ RasMol ]
    FD4  [ RasMol ]  +environment [ RasMol ]
    FD5  [ RasMol ]  +environment [ RasMol ]
    FD6  [ RasMol ]  +environment [ RasMol ]
    FD7  [ RasMol ]  +environment [ RasMol ]
    FD8  [ RasMol ]  +environment [ RasMol ]
    FD9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    GD1  [ RasMol ]  +environment [ RasMol ]
    GD2  [ RasMol ]  +environment [ RasMol ]
    GD3  [ RasMol ]  +environment [ RasMol ]
    GD4  [ RasMol ]  +environment [ RasMol ]
    GD5  [ RasMol ]  +environment [ RasMol ]
    GD6  [ RasMol ]  +environment [ RasMol ]
    GD7  [ RasMol ]  +environment [ RasMol ]
    GD8  [ RasMol ]  +environment [ RasMol ]
    GD9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    HD1  [ RasMol ]  +environment [ RasMol ]
    HD2  [ RasMol ]  +environment [ RasMol ]
    HD3  [ RasMol ]  +environment [ RasMol ]
    HD4  [ RasMol ]  +environment [ RasMol ]
    HD5  [ RasMol ]  +environment [ RasMol ]
    HD6  [ RasMol ]  +environment [ RasMol ]
    HD7  [ RasMol ]  +environment [ RasMol ]
    HD8  [ RasMol ]  +environment [ RasMol ]
    HD9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    ID1  [ RasMol ]  +environment [ RasMol ]
    ID2  [ RasMol ]  +environment [ RasMol ]
    ID3  [ RasMol ]  +environment [ RasMol ]
    ID4  [ RasMol ]  +environment [ RasMol ]
    ID5  [ RasMol ]  +environment [ RasMol ]
    ID6  [ RasMol ]  +environment [ RasMol ]
    ID7  [ RasMol ]  +environment [ RasMol ]
    ID8  [ RasMol ]  +environment [ RasMol ]
    ID9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    JD1  [ RasMol ]  +environment [ RasMol ]
    JD2  [ RasMol ]  +environment [ RasMol ]
    JD3  [ RasMol ]  +environment [ RasMol ]
    JD4  [ RasMol ]  +environment [ RasMol ]
    JD5  [ RasMol ]  +environment [ RasMol ]
    JD6  [ RasMol ]  +environment [ RasMol ]
    JD7  [ RasMol ]  +environment [ RasMol ]
    JD8  [ RasMol ]  +environment [ RasMol ]
    JD9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    KD1  [ RasMol ]  +environment [ RasMol ]
    KD2  [ RasMol ]  +environment [ RasMol ]
    KD3  [ RasMol ]  +environment [ RasMol ]
    KD4  [ RasMol ]  +environment [ RasMol ]
    KD5  [ RasMol ]  +environment [ RasMol ]
    KD6  [ RasMol ]  +environment [ RasMol ]
    KD7  [ RasMol ]  +environment [ RasMol ]
    KD8  [ RasMol ]  +environment [ RasMol ]
    KD9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    LD1  [ RasMol ]  +environment [ RasMol ]
    LD2  [ RasMol ]  +environment [ RasMol ]
    LD3  [ RasMol ]  +environment [ RasMol ]
    LD4  [ RasMol ]  +environment [ RasMol ]
    LD5  [ RasMol ]  +environment [ RasMol ]
    LD6  [ RasMol ]  +environment [ RasMol ]
    LD7  [ RasMol ]  +environment [ RasMol ]
    LD8  [ RasMol ]  +environment [ RasMol ]
    LD9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    MD1  [ RasMol ]  +environment [ RasMol ]
    MD2  [ RasMol ]  +environment [ RasMol ]
    MD3  [ RasMol ]  +environment [ RasMol ]
    MD4  [ RasMol ]  +environment [ RasMol ]
    MD5  [ RasMol ]  +environment [ RasMol ]
    MD6  [ RasMol ]  +environment [ RasMol ]
    MD7  [ RasMol ]  +environment [ RasMol ]
    MD8  [ RasMol ]  +environment [ RasMol ]
    MD9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    ND1  [ RasMol ]  +environment [ RasMol ]
    ND2  [ RasMol ]  +environment [ RasMol ]
    ND3  [ RasMol ]  +environment [ RasMol ]
    ND4  [ RasMol ]  +environment [ RasMol ]
    ND5  [ RasMol ]  +environment [ RasMol ]
    ND6  [ RasMol ]  +environment [ RasMol ]
    ND7  [ RasMol ]  +environment [ RasMol ]
    ND8  [ RasMol ]  +environment [ RasMol ]
    ND9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
    OD1  [ RasMol ]  +environment [ RasMol ]
    OD2  [ RasMol ]  +environment [ RasMol ]
    OD3  [ RasMol ]  +environment [ RasMol ]
    OD4  [ RasMol ]  +environment [ RasMol ]
    OD5  [ RasMol ]  +environment [ RasMol ]
    OD6  [ RasMol ]  +environment [ RasMol ]
    OD7  [ RasMol ]  +environment [ RasMol ]
    OD8  [ RasMol ]  +environment [ RasMol ]
    OD9  [ RasMol ]  +environment [ RasMol ]
    PC1  [ RasMol ]  +environment [ RasMol ]
    PC2  [ RasMol ]  +environment [ RasMol ]
    PC3  [ RasMol ]  +environment [ RasMol ]
    PC4  [ RasMol ]  +environment [ RasMol ]
    PC5  [ RasMol ]  +environment [ RasMol ]
    PC6  [ RasMol ]  +environment [ RasMol ]
    PC7  [ RasMol ]  +environment [ RasMol ]
    PC8  [ RasMol ]  +environment [ RasMol ]
    PC9  [ RasMol ]  +environment [ RasMol ]
    PD1  [ RasMol ]  +environment [ RasMol ]
    PD2  [ RasMol ]  +environment [ RasMol ]
    PD3  [ RasMol ]  +environment [ RasMol ]
    PD4  [ RasMol ]  +environment [ RasMol ]
    PD5  [ RasMol ]  +environment [ RasMol ]
    PD6  [ RasMol ]  +environment [ RasMol ]
    PD7  [ RasMol ]  +environment [ RasMol ]
    PD8  [ RasMol ]  +environment [ RasMol ]
    PD9  [ RasMol ]  +environment [ RasMol ]
    QC1  [ RasMol ]  +environment [ RasMol ]
    QC2  [ RasMol ]  +environment [ RasMol ]
    QC3  [ RasMol ]  +environment [ RasMol ]
    QC4  [ RasMol ]  +environment [ RasMol ]
    QC5  [ RasMol ]  +environment [ RasMol ]
    QC6  [ RasMol ]  +environment [ RasMol ]
    QC7  [ RasMol ]  +environment [ RasMol ]
    QC8  [ RasMol ]  +environment [ RasMol ]
    QC9  [ RasMol ]  +environment [ RasMol ]
    QD1  [ RasMol ]  +environment [ RasMol ]
    QD2  [ RasMol ]  +environment [ RasMol ]
    QD3  [ RasMol ]  +environment [ RasMol ]
    QD4  [ RasMol ]  +environment [ RasMol ]
    QD5  [ RasMol ]  +environment [ RasMol ]
    QD6  [ RasMol ]  +environment [ RasMol ]
    QD7  [ RasMol ]  +environment [ RasMol ]
    QD8  [ RasMol ]  +environment [ RasMol ]
    QD9  [ RasMol ]  +environment [ RasMol ]
    RC1  [ RasMol ]  +environment [ RasMol ]
    RC2  [ RasMol ]  +environment [ RasMol ]
    RC3  [ RasMol ]  +environment [ RasMol ]
    RC4  [ RasMol ]  +environment [ RasMol ]
    RC5  [ RasMol ]  +environment [ RasMol ]
    RC6  [ RasMol ]  +environment [ RasMol ]
    RC7  [ RasMol ]  +environment [ RasMol ]
    RC8  [ RasMol ]  +environment [ RasMol ]
    RC9  [ RasMol ]  +environment [ RasMol ]
    RD1  [ RasMol ]  +environment [ RasMol ]
    RD2  [ RasMol ]  +environment [ RasMol ]
    RD3  [ RasMol ]  +environment [ RasMol ]
    RD4  [ RasMol ]  +environment [ RasMol ]
    RD5  [ RasMol ]  +environment [ RasMol ]
    RD6  [ RasMol ]  +environment [ RasMol ]
    RD7  [ RasMol ]  +environment [ RasMol ]
    RD8  [ RasMol ]  +environment [ RasMol ]
    RD9  [ RasMol ]  +environment [ RasMol ]
    SC1  [ RasMol ]  +environment [ RasMol ]
    SC2  [ RasMol ]  +environment [ RasMol ]
    SC3  [ RasMol ]  +environment [ RasMol ]
    SC4  [ RasMol ]  +environment [ RasMol ]
    SC5  [ RasMol ]  +environment [ RasMol ]
    SC6  [ RasMol ]  +environment [ RasMol ]
    SC7  [ RasMol ]  +environment [ RasMol ]
    SC8  [ RasMol ]  +environment [ RasMol ]
    SC9  [ RasMol ]  +environment [ RasMol ]
    SD1  [ RasMol ]  +environment [ RasMol ]
    SD2  [ RasMol ]  +environment [ RasMol ]
    SD3  [ RasMol ]  +environment [ RasMol ]
    SD4  [ RasMol ]  +environment [ RasMol ]
    SD5  [ RasMol ]  +environment [ RasMol ]
    SD6  [ RasMol ]  +environment [ RasMol ]
    SD7  [ RasMol ]  +environment [ RasMol ]
    SD8  [ RasMol ]  +environment [ RasMol ]
    SD9  [ RasMol ]  +environment [ RasMol ]
    TC1  [ RasMol ]  +environment [ RasMol ]
    TC2  [ RasMol ]  +environment [ RasMol ]
    TC3  [ RasMol ]  +environment [ RasMol ]
    TC4  [ RasMol ]  +environment [ RasMol ]
    TC5  [ RasMol ]  +environment [ RasMol ]
    TC6  [ RasMol ]  +environment [ RasMol ]
    TC7  [ RasMol ]  +environment [ RasMol ]
    TC8  [ RasMol ]  +environment [ RasMol ]
    TC9  [ RasMol ]  +environment [ RasMol ]
    TD1  [ RasMol ]  +environment [ RasMol ]
    TD2  [ RasMol ]  +environment [ RasMol ]
    TD3  [ RasMol ]  +environment [ RasMol ]
    TD4  [ RasMol ]  +environment [ RasMol ]
    TD5  [ RasMol ]  +environment [ RasMol ]
    TD6  [ RasMol ]  +environment [ RasMol ]
    TD7  [ RasMol ]  +environment [ RasMol ]
    TD8  [ RasMol ]  +environment [ RasMol ]
    TD9  [ RasMol ]  +environment [ RasMol ]
    UC1  [ RasMol ]  +environment [ RasMol ]
    UC2  [ RasMol ]  +environment [ RasMol ]
    UC3  [ RasMol ]  +environment [ RasMol ]
    UC4  [ RasMol ]  +environment [ RasMol ]
    UC5  [ RasMol ]  +environment [ RasMol ]
    UC6  [ RasMol ]  +environment [ RasMol ]
    UC7  [ RasMol ]  +environment [ RasMol ]
    UC8  [ RasMol ]  +environment [ RasMol ]
    UC9  [ RasMol ]  +environment [ RasMol ]
    UD1  [ RasMol ]  +environment [ RasMol ]
    UD2  [ RasMol ]  +environment [ RasMol ]
    UD3  [ RasMol ]  +environment [ RasMol ]
    UD4  [ RasMol ]  +environment [ RasMol ]
    UD5  [ RasMol ]  +environment [ RasMol ]
    UD6  [ RasMol ]  +environment [ RasMol ]
    UD7  [ RasMol ]  +environment [ RasMol ]
    UD8  [ RasMol ]  +environment [ RasMol ]
    UD9  [ RasMol ]  +environment [ RasMol ]
    VC1  [ RasMol ]  +environment [ RasMol ]
    VC2  [ RasMol ]  +environment [ RasMol ]
    VC3  [ RasMol ]  +environment [ RasMol ]
    VC4  [ RasMol ]  +environment [ RasMol ]
    VC5  [ RasMol ]  +environment [ RasMol ]
    VC6  [ RasMol ]  +environment [ RasMol ]
    VC7  [ RasMol ]  +environment [ RasMol ]
    VC8  [ RasMol ]  +environment [ RasMol ]
    VC9  [ RasMol ]  +environment [ RasMol ]
    VD1  [ RasMol ]  +environment [ RasMol ]
    VD2  [ RasMol ]  +environment [ RasMol ]
    VD3  [ RasMol ]  +environment [ RasMol ]
    VD4  [ RasMol ]  +environment [ RasMol ]
    VD5  [ RasMol ]  +environment [ RasMol ]
    VD6  [ RasMol ]  +environment [ RasMol ]
    VD7  [ RasMol ]  +environment [ RasMol ]
    VD8  [ RasMol ]  +environment [ RasMol ]
    VD9  [ RasMol ]  +environment [ RasMol ]
    WC1  [ RasMol ]  +environment [ RasMol ]
    WC2  [ RasMol ]  +environment [ RasMol ]
    WC3  [ RasMol ]  +environment [ RasMol ]
    WC4  [ RasMol ]  +environment [ RasMol ]
    WC5  [ RasMol ]  +environment [ RasMol ]
    WC6  [ RasMol ]  +environment [ RasMol ]
    WC7  [ RasMol ]  +environment [ RasMol ]
    WC8  [ RasMol ]  +environment [ RasMol ]
    WC9  [ RasMol ]  +environment [ RasMol ]
    WD1  [ RasMol ]  +environment [ RasMol ]
    WD2  [ RasMol ]  +environment [ RasMol ]
    WD3  [ RasMol ]  +environment [ RasMol ]
    WD4  [ RasMol ]  +environment [ RasMol ]
    WD5  [ RasMol ]  +environment [ RasMol ]
    WD6  [ RasMol ]  +environment [ RasMol ]
    WD7  [ RasMol ]  +environment [ RasMol ]
    WD8  [ RasMol ]  +environment [ RasMol ]
    WD9  [ RasMol ]  +environment [ RasMol ]
    XC1  [ RasMol ]  +environment [ RasMol ]
    XC2  [ RasMol ]  +environment [ RasMol ]
    XC3  [ RasMol ]  +environment [ RasMol ]
    XC4  [ RasMol ]  +environment [ RasMol ]
    XC5  [ RasMol ]  +environment [ RasMol ]
    XC6  [ RasMol ]  +environment [ RasMol ]
    XC7  [ RasMol ]  +environment [ RasMol ]
    XC8  [ RasMol ]  +environment [ RasMol ]
    XC9  [ RasMol ]  +environment [ RasMol ]
    XD1  [ RasMol ]  +environment [ RasMol ]
    XD2  [ RasMol ]  +environment [ RasMol ]
    XD3  [ RasMol ]  +environment [ RasMol ]
    XD4  [ RasMol ]  +environment [ RasMol ]
    XD5  [ RasMol ]  +environment [ RasMol ]
    XD6  [ RasMol ]  +environment [ RasMol ]
    YC1  [ RasMol ]  +environment [ RasMol ]
    YC2  [ RasMol ]  +environment [ RasMol ]
    YC3  [ RasMol ]  +environment [ RasMol ]
    YC4  [ RasMol ]  +environment [ RasMol ]
    YC5  [ RasMol ]  +environment [ RasMol ]
    YC6  [ RasMol ]  +environment [ RasMol ]
    YC7  [ RasMol ]  +environment [ RasMol ]
    YC8  [ RasMol ]  +environment [ RasMol ]
    YC9  [ RasMol ]  +environment [ RasMol ]
    ZC1  [ RasMol ]  +environment [ RasMol ]
    ZC2  [ RasMol ]  +environment [ RasMol ]
    ZC3  [ RasMol ]  +environment [ RasMol ]
    ZC4  [ RasMol ]  +environment [ RasMol ]
    ZC5  [ RasMol ]  +environment [ RasMol ]
    ZC6  [ RasMol ]  +environment [ RasMol ]
    ZC7  [ RasMol ]  +environment [ RasMol ]
    ZC8  [ RasMol ]  +environment [ RasMol ]
    ZC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:26 - Pro A:27   [ RasMol ]  
    Glu B:26 - Pro B:27   [ RasMol ]  
    Glu K:26 - Pro K:27   [ RasMol ]  
    Glu L:26 - Pro L:27   [ RasMol ]  
    Leu C:165 - Pro C:166   [ RasMol ]  
    Leu M:165 - Pro M:166   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1iw7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SKW1_THET8 | Q5SKW1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  RPOA_THETH | Q9Z9H6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP