Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  COORDINATES OF THE THERMUS THERMOPHILUS 30S COMPONENTS NEIGHBORING RBFA AS OBTAINED BY FITTING INTO THE CRYO-EM MAP OF A 30S-RBFA COMPLEX
 
Authors :  P. P. Datta, D. N. Wilson, M. Kawazoe, N. K. Swami, T. Kaminishi, M. R. Sha T. M. Booth, C. Takemoto, P. Fucini, S. Yokoyama, R. K. Agrawal
Date :  22 Aug 07  (Deposition) - 18 Mar 08  (Release) - 13 Jul 11  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  12.50
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,X
Keywords :  30S Ribosome Maturation Protein Rbfa, Cold Shock Response Protein Rbfa, 30S-Rbfa Complex, Rbfa Binding Site On The 30S, Ribonucleoprotein, Ribosomal Protein, Rna-Binding, Rrna-Binding, Trna-Binding, Antibiotic Resistance, Ribosomal Protein-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. P. Datta, D. N. Wilson, M. Kawazoe, N. K. Swami, T. Kaminishi, M. R. Sharma, T. M. Booth, C. Takemoto, P. Fucini, S. Yokoyama, R. K. Agrawal
Structural Aspects Of Rbfa Action During Small Ribosomal Subunit Assembly.
Mol. Cell V. 28 434 2007
PubMed-ID: 17996707  |  Reference-DOI: 10.1016/J.MOLCEL.2007.08.026
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 30S RIBOSOMAL PROTEIN S9
    Chains: G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: RPSI, RPS9
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 262724
    Strain: HB27
 
Molecule 2 - 30S RIBOSOMAL PROTEIN S12
    Chains: H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUES 5-128
    Gene: RPSL, RPS12
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 262724
    Strain: HB27
 
Molecule 3 - 30S RIBOSOMAL PROTEIN S13
    Chains: I
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: RPSM, RPS13
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 262724
    Strain: HB27
 
Molecule 4 - 16S RIBOSOMAL RNA HELIX 1
    Chains: A
    Engineered: YES
    Synthetic: YES
 
Molecule 5 - 16S RIBOSOMAL RNA HELIX 18
    Chains: B
    Engineered: YES
    Synthetic: YES
 
Molecule 6 - 16S RIBOSOMAL RNA HELIX 27
    Chains: C
    Engineered: YES
    Synthetic: YES
 
Molecule 7 - 16S RIBOSOMAL RNA HELIX 28
    Chains: D
    Engineered: YES
    Synthetic: YES
 
Molecule 8 - 16S RIBOSOMAL RNA HELIX 44
    Chains: E
    Engineered: YES
    Synthetic: YES
 
Molecule 9 - 16S RIBOSOMAL RNA HELIX 44
    Chains: X
    Engineered: YES
    Synthetic: YES
 
Molecule 10 - 16S RIBOSOMAL RNA HELIX 45
    Chains: F
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric/Biological Unit : ABCDEFGHIX

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2R1G)

(-) Sites  (0, 0)

(no "Site" information available for 2R1G)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2R1G)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2R1G)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (7, 7)

Asymmetric/Biological Unit (7, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RS12_THETH_001 *P42SRS12_THETH  ---  ---HP45S
2UniProtVAR_RS12_THETH_002 *K43RRS12_THETH  ---  ---HK46R
3UniProtVAR_RS12_THETH_003 *R86CRS12_THETH  ---  ---HR89C
4UniProtVAR_RS12_THETH_004 *R86HRS12_THETH  ---  ---HR89H
5UniProtVAR_RS12_THETH_005 *K88ERS12_THETH  ---  ---HK91E
6UniProtVAR_RS12_THETH_006 *K88RRS12_THETH  ---  ---HK91R
7UniProtVAR_RS12_THETH_007 *P91LRS12_THETH  ---  ---HP94L
   * ID not provided by source
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S13_2PS50159 Ribosomal protein S13 family profile.RS13_THET24-112  1I:4-112
2RIBOSOMAL_S12PS00055 Ribosomal protein S12 signature.RS12_THET243-50  1H:46-53
RS12_THETH43-50  1H:46-53
3RIBOSOMAL_S9PS00360 Ribosomal protein S9 signature.RS9_THET267-85  1G:67-85
4RIBOSOMAL_S13_1PS00646 Ribosomal protein S13 signature.RS13_THET288-101  1I:88-101

(-) Exons   (0, 0)

(no "Exon" information available for 2R1G)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:RNA  Length:24
                                                         
                2r1g A    6 GGAGAGUUUGAUCCUGGCUCAGGG   29
                                    15        25    


Chain B from PDB  Type:RNA  Length:48
                                                                                 
                2r1g B  500 GCGCCGGCCAACUCCGUGCCAGCAGCCGCGGUAAUACGGAGGGCGCGA  547
                                   509       519       529       539        


Chain C from PDB  Type:RNA  Length:29
                                                              
                2r1g C  885 GGGGAGUACGGCCGCAAGGCUGAAACUCA  913
                                   894       904         


Chain D from PDB  Type:RNA  Length:28
                                                             
                2r1g D  918 AAUUGACGGGGGCCGCCUUGUACACACC  945
                                   927       937        


Chain E from PDB  Type:RNA  Length:11
                                            
                2r1g E 1400 CGCCCGUCACG 1410
                                  1409 


Chain F from PDB  Type:RNA  Length:29
                                                              
                2r1g F 1501 CAAGGUAGCUGUACCGGAAGGUGCGGCUG 1529
                                  1510      1520         


Chain G from PDB  Type:PROTEIN  Length:127
 aligned with RS9_THET2 | P62669 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:127
                                    11        21        31        41        51        61        71        81        91       101       111       121       
           RS9_THET2      2 EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR  128
               SCOP domains d2r1gg1 G:2-128 Ribosomal protein S9                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------RIBOSOMAL_S9       ------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                2r1g G    2 EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR  128
                                    11        21        31        41        51        61        71        81        91       101       111       121       


Chain H from PDB  Type:PROTEIN  Length:124
 aligned with RS12_THET2 | P61941 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:124
                                    11        21        31        41        51        61        71        81        91       101       111       121    
          RS12_THET2      2 PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA  125
               SCOP domains d2r1gh1 H:5-128 70S ribosome functional complex                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................................................ Sec.struct. author
             SAPs(SNPs) (1) ----------------------------------------SR------------------------------------------C-E--L---------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------H-R------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------RIBOSOMA--------------------------------------------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                2r1g H    5 PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA  128
                                    14        24        34        44        54        64        74        84        94       104       114       124    


Chain H from PDB  Type:PROTEIN  Length:124
 aligned with RS12_THETH | P17293 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:124
                                    11        21        31        41        51        61        71        81        91       101       111       121    
          RS12_THETH      2 PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA  125
               SCOP domains d2r1gh1 H:5-128 70S ribosome functional complex                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................................................ Sec.struct. author
             SAPs(SNPs) (1) ----------------------------------------SR------------------------------------------C-E--L---------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------H-R------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) -----------------------------------------RIBOSOMA--------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                2r1g H    5 PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA  128
                                    14        24        34        44        54        64        74        84        94       104       114       124    


Chain I from PDB  Type:PROTEIN  Length:125
 aligned with RS13_THET2 | P62655 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:125
                                    11        21        31        41        51        61        71        81        91       101       111       121     
          RS13_THET2      2 ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK  126
               SCOP domains d2r1gi1 I:2-126 Ribosomal protein S13                                                                                         SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................................................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --RIBOSOMAL_S13_2  PDB: I:4-112 UniProt: 4-112                                                                 -------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------RIBOSOMAL_S13_------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                2r1g I    2 ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK  126
                                    11        21        31        41        51        61        71        81        91       101       111       121     


Chain X from PDB  Type:RNA  Length:11
                                            
                2r1g X 1490 CGAAGUCGUAA 1500
                                  1499
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Low resolution protein structures (283)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2R1G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2R1G)

(-) Gene Ontology  (11, 35)

Asymmetric/Biological Unit(hide GO term definitions)
Chain G   (RS9_THET2 | P62669)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain H   (RS12_THET2 | P61941)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain H   (RS12_THETH | P17293)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain I   (RS13_THET2 | P62655)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2r1g)
 
  Sites
(no "Sites" information available for 2r1g)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2r1g)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2r1g
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RS12_THET2 | P61941
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RS12_THETH | P17293
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RS13_THET2 | P62655
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RS9_THET2 | P62669
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RS12_THET2 | P61941
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RS12_THETH | P17293
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RS13_THET2 | P62655
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RS9_THET2 | P62669
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RS12_THET2 | P61941: 4kvb 4v4i 4v4j 4v63 4v67 4v7p 4v83 4v84 4v9j 4v9k 4v9l 4v9m 4v9n 4v9q 4w29 4xej 5j4d
        RS12_THETH | P17293: 1fjg 1hnw 1hnx 1hnz 1hr0 1i94 1i95 1i96 1i97 1ibk 1ibl 1ibm 1j5e 1l1u 1n32 1n33 1twt 2f4v 2hhh 2om7 3oto 4aqy 4v8x
        RS13_THET2 | P62655: 4kvb 4v4i 4v4j 4v63 4v67 4v7p 4v83 4v84 4v9j 4v9k 4v9l 4v9m 4v9n 4v9q 4w29 4xej 5j4d
        RS9_THET2 | P62669: 1i94 1i96 1twt 2e5l 2f4v 2uua 2uxb 2uxc 2uxd 2vqe 2vqf 2zm6 3t1h 3t1y 4kvb 4v4i 4v4j 4v51 4v5a 4v5c 4v5d 4v63 4v67 4v7p 4v83 4v84 4v9j 4v9k 4v9l 4v9m 4v9n 4v9q 4w29 4xej 5j4d

(-) Related Entries Specified in the PDB File

1j5e 30S X-RAY CRYSTALLOGRAPHIC STRUCTURE
2dyj RBFA X-RAY CRYSTALLOGRAPHIC STRUCTURE RELATED ID: EMD-1413 RELATED DB: EMDB
2r1c RBFA HOMOLOGY MODEL FITTED INTO 30S-RBFA CRYO-EM MAP