Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A DIMERIC N-TERMINAL FRAGMENT OF HUMAN UBIQUITIN
 
Authors :  D. Bolton, P. A. Evans, K. Stott, R. W. Broadhurst
Date :  06 Aug 01  (Deposition) - 13 Dec 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (16x)
Keywords :  Ubiquitin, Dimer, Protein Dissection (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Bolton, P. A. Evans, K. Stott, R. W. Broadhurst
Structure And Properties Of A Dimeric N-Terminal Fragment Of Human Ubiquitin.
J. Mol. Biol. V. 314 773 2001
PubMed-ID: 11733996  |  Reference-DOI: 10.1006/JMBI.2001.5181

(-) Compounds

Molecule 1 - UBIQUITIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-4T3
    Expression System StrainBL21
    Expression System Taxid511693
    FragmentRESIDUES 1-51
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsFRAGMENT CONTAINS FIRST 51 RESIDUES OF HUMAN UBIQUITIN PRECEDED AT THE N-TERMINUS BY GLYCINE AND SERINE

 Structural Features

(-) Chains, Units

  
NMR Structure (16x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1GJZ)

(-) Sites  (0, 0)

(no "Site" information available for 1GJZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1GJZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1GJZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1GJZ)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.UBIQP_CRIGR1-76
77-152
153-228
229-304
305-380
381-456
457-532
 
533-608
  2-
-
-
-
-
-
A:1-51
B:1-51
-
RS27A_BOVIN1-76
 
  2A:1-51
B:1-51
RS27A_CAVPO1-76
 
  2A:1-51
B:1-51
RS27A_CHICK1-76
 
  2A:1-51
B:1-51
RL40_MOUSE1-76
 
  2A:1-51
B:1-51
RL40_PIG1-76
 
  2A:1-51
B:1-51
RL40_RAT1-76
 
  2A:1-51
B:1-51
RS27A_HUMAN1-76
 
  2A:1-51
B:1-51
UBC_MOUSE1-76
77-152
153-228
229-304
305-380
381-456
457-532
533-608
609-684
 
  2-
-
-
-
-
-
-
-
A:1-51
B:1-51
UBC_PIG1-76
77-152
153-228
229-304
305-380
381-456
457-532
 
  2-
-
-
-
-
-
A:1-51
B:1-51
UBIQ_RABIT1-76
 
  2A:1-51
B:1-51
UBB_RAT1-76
77-152
153-228
229-304
 
  2-
-
-
A:1-51
B:1-51
RS27A_RAT1-76
 
  2A:1-51
B:1-51
RS27A_MOUSE1-76
 
  2A:1-51
B:1-51
RL40_BOVIN1-76
 
  2A:1-51
B:1-51
RL40_HUMAN1-76
 
  2A:1-51
B:1-51
UBB_BOVIN1-76
77-152
153-228
229-304
 
  2-
-
-
A:1-51
B:1-51
UBB_CAVPO1-76
77-152
153-228
229-304
 
  2-
-
-
A:1-51
B:1-51
UBB_CHICK1-76
77-152
153-228
229-304
 
  2-
-
-
A:1-51
B:1-51
UBB_HUMAN1-76
77-152
153-228
 
  2-
-
A:1-51
B:1-51
UBB_MOUSE1-76
77-152
153-228
229-304
 
  2-
-
-
A:1-51
B:1-51
UBC_BOVIN1-76
77-152
153-228
229-304
305-380
381-456
457-532
533-608
609-684
 
  2-
-
-
-
-
-
-
-
A:1-51
B:1-51
UBC_HUMAN1-76
77-152
153-228
229-304
305-380
381-456
457-532
533-608
609-684
 
  2-
-
-
-
-
-
-
-
A:1-51
B:1-51
UBIQP_XENLA16-91
92-167
 
  2-
A:1-51
B:1-51
2UBIQUITIN_1PS00299 Ubiquitin domain signature.UBIQP_CRIGR27-52
103-128
179-204
255-280
331-356
407-432
483-508
 
559-584
  2-
-
-
-
-
-
A:27-51
B:27-51
-
RS27A_BOVIN27-52
 
  2A:27-51
B:27-51
RS27A_CAVPO27-52
 
  2A:27-51
B:27-51
RS27A_CHICK27-52
 
  2A:27-51
B:27-51
RL40_MOUSE27-52
 
  2A:27-51
B:27-51
RL40_PIG27-52
 
  2A:27-51
B:27-51
RL40_RAT27-52
 
  2A:27-51
B:27-51
RS27A_HUMAN27-52
 
  2A:27-51
B:27-51
UBC_MOUSE27-52
103-128
179-204
255-280
331-356
407-432
483-508
559-584
635-660
 
  2-
-
-
-
-
-
-
-
A:27-51
B:27-51
UBC_PIG27-52
103-128
179-204
255-280
331-356
407-432
483-508
 
  2-
-
-
-
-
-
A:27-51
B:27-51
UBIQ_RABIT27-52
 
  2A:27-51
B:27-51
UBB_RAT27-52
103-128
179-204
255-280
 
  2-
-
-
A:27-51
B:27-51
RS27A_RAT27-52
 
  2A:27-51
B:27-51
RS27A_MOUSE27-52
 
  2A:27-51
B:27-51
RL40_BOVIN27-52
 
  2A:27-51
B:27-51
RL40_HUMAN27-52
 
  2A:27-51
B:27-51
UBB_BOVIN27-52
103-128
179-204
255-280
 
  2-
-
-
A:27-51
B:27-51
UBB_CAVPO27-52
103-128
179-204
255-280
 
  2-
-
-
A:27-51
B:27-51
UBB_CHICK27-52
103-128
179-204
255-280
 
  2-
-
-
A:27-51
B:27-51
UBB_HUMAN27-52
103-128
179-204
 
  2-
-
A:27-51
B:27-51
UBB_MOUSE27-52
103-128
179-204
255-280
 
  2-
-
-
A:27-51
B:27-51
UBC_BOVIN27-52
103-128
179-204
255-280
331-356
407-432
483-508
559-584
635-660
 
  2-
-
-
-
-
-
-
-
A:27-51
B:27-51
UBC_HUMAN27-52
103-128
179-204
255-280
331-356
407-432
483-508
559-584
635-660
 
  2-
-
-
-
-
-
-
-
A:27-51
B:27-51
UBIQP_XENLA42-67
118-143
 
  2-
A:27-51
B:27-51

(-) Exons   (0, 0)

(no "Exon" information available for 1GJZ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RL40_BOVIN | P63048 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_BOVIN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (39)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RL40_HUMAN | P62987 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_HUMAN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (26)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RL40_MOUSE | P62984 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_MOUSE     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (27)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RL40_PIG | P63053 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
             RL40_PIG     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (25)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RL40_RAT | P62986 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
             RL40_RAT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (24)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_BOVIN | P62992 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_BOVIN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
               PROSITE (46) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (46)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_CAVPO | P62978 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_CAVPO     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (36)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_CHICK | P79781 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_CHICK     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (31)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_HUMAN | P62979 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_HUMAN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (35)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_MOUSE | P62983 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_MOUSE     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (28)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_RAT | P62982 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
            RS27A_RAT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (42)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_BOVIN | P0CG53 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_BOVIN   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (1) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 229-304           PROSITE (1)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_CAVPO | P0CG54 from UniProtKB/Swiss-Prot  Length:311

    Alignment length:53
                                   236       246       256       266       276   
            UBB_CAVPO   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) --UBIQUITIN_2  PDB: A:1-51 UniProt: 229-304           PROSITE (7)
                PROSITE (8) UB--------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_CHICK | P0CG62 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_CHICK   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) --UBIQUITIN_2  PDB: A:1-51 UniProt: 229-304           PROSITE (8)
                PROSITE (9) UB--------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_HUMAN | P0CG47 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:53
                                   160       170       180       190       200   
            UBB_HUMAN   151 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 203
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 153-228           PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_MOUSE | P0CG49 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_MOUSE   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 229-304           PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBB_RAT | P0CG51 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
              UBB_RAT   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 229-304           PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBC_BOVIN | P0CH28 from UniProtKB/Swiss-Prot  Length:690

    Alignment length:53
                                   616       626       636       646       656   
            UBC_BOVIN   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (1) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 609-684           PROSITE (1)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBC_HUMAN | P0CG48 from UniProtKB/Swiss-Prot  Length:685

    Alignment length:53
                                   616       626       636       646       656   
            UBC_HUMAN   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 609-684           PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBC_MOUSE | P0CG50 from UniProtKB/Swiss-Prot  Length:734

    Alignment length:53
                                   616       626       636       646       656   
            UBC_MOUSE   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 609-684           PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBC_PIG | P0CG68 from UniProtKB/Swiss-Prot  Length:533

    Alignment length:53
                                   464       474       484       494       504   
              UBC_PIG   455 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 507
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 457-532           PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBIQP_CRIGR | P62976 from UniProtKB/Swiss-Prot  Length:658

    Alignment length:53
                                   464       474       484       494       504   
          UBIQP_CRIGR   455 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 507
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (1) UBUBIQUITIN_2  PDB: A:1-51 UniProt: 457-532           PROSITE (1)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBIQP_XENLA | P62972 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:53
                                    99       109       119       129       139   
          UBIQP_XENLA    90 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 142
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) --UBIQUITIN_2  PDB: A:1-51 UniProt: 92-167            PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) UB--------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
               PROSITE (46) ----------------------------------------------------- PROSITE (46)
               PROSITE (47) ----------------------------------------------------- PROSITE (47)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain A from PDB  Type:PROTEIN  Length:53
 aligned with UBIQ_RABIT | P62975 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           UBIQ_RABIT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjza_ A: Ubiquitin                                  SCOP domains
               CATH domains 1gjzA00 A:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_2  PDB: A:1-51 UniProt: 1-76              PROSITE (1)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------UBIQUITIN_1  PDB: A:27-51 PROSITE (32)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz A  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RL40_BOVIN | P63048 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_BOVIN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (39)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RL40_HUMAN | P62987 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_HUMAN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (26)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RL40_MOUSE | P62984 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           RL40_MOUSE     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (27)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RL40_PIG | P63053 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
             RL40_PIG     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (25)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RL40_RAT | P62986 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
             RL40_RAT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (24)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_BOVIN | P62992 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_BOVIN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
               PROSITE (46) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (46)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_CAVPO | P62978 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_CAVPO     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (36)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_CHICK | P79781 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_CHICK     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (31)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_HUMAN | P62979 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_HUMAN     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (35)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_MOUSE | P62983 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
          RS27A_MOUSE     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (28)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RS27A_RAT | P62982 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
            RS27A_RAT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (42)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_BOVIN | P0CG53 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_BOVIN   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (1) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 229-304           PROSITE (1)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_CAVPO | P0CG54 from UniProtKB/Swiss-Prot  Length:311

    Alignment length:53
                                   236       246       256       266       276   
            UBB_CAVPO   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) --UBIQUITIN_2  PDB: B:1-51 UniProt: 229-304           PROSITE (7)
                PROSITE (8) UB--------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_CHICK | P0CG62 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_CHICK   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) --UBIQUITIN_2  PDB: B:1-51 UniProt: 229-304           PROSITE (8)
                PROSITE (9) UB--------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_HUMAN | P0CG47 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:53
                                   160       170       180       190       200   
            UBB_HUMAN   151 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 203
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 153-228           PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_MOUSE | P0CG49 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
            UBB_MOUSE   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 229-304           PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBB_RAT | P0CG51 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:53
                                   236       246       256       266       276   
              UBB_RAT   227 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 279
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 229-304           PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBC_BOVIN | P0CH28 from UniProtKB/Swiss-Prot  Length:690

    Alignment length:53
                                   616       626       636       646       656   
            UBC_BOVIN   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (1) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 609-684           PROSITE (1)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBC_HUMAN | P0CG48 from UniProtKB/Swiss-Prot  Length:685

    Alignment length:53
                                   616       626       636       646       656   
            UBC_HUMAN   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 609-684           PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBC_MOUSE | P0CG50 from UniProtKB/Swiss-Prot  Length:734

    Alignment length:53
                                   616       626       636       646       656   
            UBC_MOUSE   607 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 659
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 609-684           PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBC_PIG | P0CG68 from UniProtKB/Swiss-Prot  Length:533

    Alignment length:53
                                   464       474       484       494       504   
              UBC_PIG   455 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 507
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 457-532           PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBIQP_CRIGR | P62976 from UniProtKB/Swiss-Prot  Length:658

    Alignment length:53
                                   464       474       484       494       504   
          UBIQP_CRIGR   455 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 507
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (1) UBUBIQUITIN_2  PDB: B:1-51 UniProt: 457-532           PROSITE (1)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBIQP_XENLA | P62972 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:53
                                    99       109       119       129       139   
          UBIQP_XENLA    90 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 142
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) --UBIQUITIN_2  PDB: B:1-51 UniProt: 92-167            PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) UB--------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------------------------------- PROSITE (32)
               PROSITE (33) ----------------------------------------------------- PROSITE (33)
               PROSITE (34) ----------------------------------------------------- PROSITE (34)
               PROSITE (35) ----------------------------------------------------- PROSITE (35)
               PROSITE (36) ----------------------------------------------------- PROSITE (36)
               PROSITE (37) ----------------------------------------------------- PROSITE (37)
               PROSITE (38) ----------------------------------------------------- PROSITE (38)
               PROSITE (39) ----------------------------------------------------- PROSITE (39)
               PROSITE (40) ----------------------------------------------------- PROSITE (40)
               PROSITE (41) ----------------------------------------------------- PROSITE (41)
               PROSITE (42) ----------------------------------------------------- PROSITE (42)
               PROSITE (43) ----------------------------------------------------- PROSITE (43)
               PROSITE (44) ----------------------------------------------------- PROSITE (44)
               PROSITE (45) ----------------------------------------------------- PROSITE (45)
               PROSITE (46) ----------------------------------------------------- PROSITE (46)
               PROSITE (47) ----------------------------------------------------- PROSITE (47)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with UBIQ_RABIT | P62975 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:53
                              1                                                  
                              |      8        18        28        38        48   
           UBIQ_RABIT     - --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
               SCOP domains d1gjzb_ B: Ubiquitin                                  SCOP domains
               CATH domains 1gjzB00 B:-1-51                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee.....hhhhhhhhhhhhh.........eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_2  PDB: B:1-51 UniProt: 1-76              PROSITE (1)
                PROSITE (2) ----------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------- PROSITE (18)
               PROSITE (19) ----------------------------------------------------- PROSITE (19)
               PROSITE (20) ----------------------------------------------------- PROSITE (20)
               PROSITE (21) ----------------------------------------------------- PROSITE (21)
               PROSITE (22) ----------------------------------------------------- PROSITE (22)
               PROSITE (23) ----------------------------------------------------- PROSITE (23)
               PROSITE (24) ----------------------------------------------------- PROSITE (24)
               PROSITE (25) ----------------------------------------------------- PROSITE (25)
               PROSITE (26) ----------------------------------------------------- PROSITE (26)
               PROSITE (27) ----------------------------------------------------- PROSITE (27)
               PROSITE (28) ----------------------------------------------------- PROSITE (28)
               PROSITE (29) ----------------------------------------------------- PROSITE (29)
               PROSITE (30) ----------------------------------------------------- PROSITE (30)
               PROSITE (31) ----------------------------------------------------- PROSITE (31)
               PROSITE (32) ----------------------------UBIQUITIN_1  PDB: B:27-51 PROSITE (32)
                 Transcript ----------------------------------------------------- Transcript
                 1gjz B  -1 GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE  51
                                     8        18        28        38        48   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1GJZ)

(-) Gene Ontology  (125, 541)

NMR Structure(hide GO term definitions)
Chain A,B   (UBB_RAT | P0CG51)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (RS27A_HUMAN | P62979)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0042769    DNA damage response, detection of DNA damage    The series of events required to receive a stimulus indicating DNA damage has occurred and convert it to a molecular signal.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007249    I-kappaB kinase/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
    GO:0007254    JNK cascade    An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0002755    MyD88-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0002756    MyD88-independent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor not relying on the MyD88 adaptor molecule. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006614    SRP-dependent cotranslational protein targeting to membrane    The targeting of proteins to a membrane that occurs during translation and is dependent upon two key components, the signal-recognition particle (SRP) and the SRP receptor. SRP is a cytosolic particle that transiently binds to the endoplasmic reticulum (ER) signal sequence in a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0035666    TRIF-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the TRIF adaptor mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0060071    Wnt signaling pathway, planar cell polarity pathway    The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0031145    anaphase-promoting complex-dependent catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0016197    endosomal transport    The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0005978    glycogen biosynthetic process    The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0036297    interstrand cross-link repair    Removal of a DNA interstrand crosslink (a covalent attachment of DNA bases on opposite strands of the DNA) and restoration of the DNA. DNA interstrand crosslinks occur when both strands of duplex DNA are covalently tethered together (e.g. by an exogenous or endogenous agent), thus preventing the strand unwinding necessary for essential DNA functions such as transcription and replication.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0042059    negative regulation of epidermal growth factor receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0032480    negative regulation of type I interferon production    Any process that stops, prevents, or reduces the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0051436    negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin ligase activity that contributes to the mitotic cell cycle.
    GO:0000184    nuclear-transcribed mRNA catabolic process, nonsense-mediated decay    The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
    GO:0070423    nucleotide-binding oligomerization domain containing signaling pathway    Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0033683    nucleotide-excision repair, DNA incision    A process that results in the endonucleolytic cleavage of the damaged strand of DNA. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound.
    GO:0006296    nucleotide-excision repair, DNA incision, 5'-to lesion    The endonucleolytic cleavage of the damaged strand of DNA 5' to the site of damage. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound. The incision follows the incision formed 3' to the site of damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0045742    positive regulation of epidermal growth factor receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0010939    regulation of necrotic cell death    Any process that modulates the rate, frequency or extent of necrotic cell death. Necrotic cell death is a cell death process that is morphologically characterized by a gain in cell volume (oncosis), swelling of organelles, plasma membrane rupture and subsequent loss of intracellular contents.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0010803    regulation of tumor necrosis factor-mediated signaling pathway    Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
    GO:0032479    regulation of type I interferon production    Any process that modulates the frequency, rate, or extent of interferon type I production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051403    stress-activated MAPK cascade    A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0019083    viral transcription    The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0022627    cytosolic small ribosomal subunit    The small subunit of a ribosome located in the cytosol.
    GO:0030666    endocytic vesicle membrane    The lipid bilayer surrounding an endocytic vesicle.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain A,B   (RS27A_MOUSE | P62983)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0022627    cytosolic small ribosomal subunit    The small subunit of a ribosome located in the cytosol.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain A,B   (UBIQP_XENLA | P62972)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBC_HUMAN | P0CG48)
molecular function
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0042769    DNA damage response, detection of DNA damage    The series of events required to receive a stimulus indicating DNA damage has occurred and convert it to a molecular signal.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007249    I-kappaB kinase/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
    GO:0007254    JNK cascade    An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0002755    MyD88-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0002756    MyD88-independent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor not relying on the MyD88 adaptor molecule. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0035666    TRIF-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the TRIF adaptor mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0060071    Wnt signaling pathway, planar cell polarity pathway    The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0031145    anaphase-promoting complex-dependent catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0016197    endosomal transport    The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0005978    glycogen biosynthetic process    The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0036297    interstrand cross-link repair    Removal of a DNA interstrand crosslink (a covalent attachment of DNA bases on opposite strands of the DNA) and restoration of the DNA. DNA interstrand crosslinks occur when both strands of duplex DNA are covalently tethered together (e.g. by an exogenous or endogenous agent), thus preventing the strand unwinding necessary for essential DNA functions such as transcription and replication.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0042059    negative regulation of epidermal growth factor receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0032480    negative regulation of type I interferon production    Any process that stops, prevents, or reduces the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0051436    negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin ligase activity that contributes to the mitotic cell cycle.
    GO:0070423    nucleotide-binding oligomerization domain containing signaling pathway    Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0033683    nucleotide-excision repair, DNA incision    A process that results in the endonucleolytic cleavage of the damaged strand of DNA. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound.
    GO:0006296    nucleotide-excision repair, DNA incision, 5'-to lesion    The endonucleolytic cleavage of the damaged strand of DNA 5' to the site of damage. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound. The incision follows the incision formed 3' to the site of damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0045742    positive regulation of epidermal growth factor receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0010939    regulation of necrotic cell death    Any process that modulates the rate, frequency or extent of necrotic cell death. Necrotic cell death is a cell death process that is morphologically characterized by a gain in cell volume (oncosis), swelling of organelles, plasma membrane rupture and subsequent loss of intracellular contents.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0010803    regulation of tumor necrosis factor-mediated signaling pathway    Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
    GO:0032479    regulation of type I interferon production    Any process that modulates the frequency, rate, or extent of interferon type I production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051403    stress-activated MAPK cascade    A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0010992    ubiquitin recycling    Any process involved in the maintenance of an internal steady state of ubiquitin monomers and free ubiquitin chains at the level of the cell by recycling ubiquitin from proteasome-bound ubiquitinated intermediates.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030666    endocytic vesicle membrane    The lipid bilayer surrounding an endocytic vesicle.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B   (RL40_PIG | P63053)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (UBB_HUMAN | P0CG47)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0042769    DNA damage response, detection of DNA damage    The series of events required to receive a stimulus indicating DNA damage has occurred and convert it to a molecular signal.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007249    I-kappaB kinase/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
    GO:0007254    JNK cascade    An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0002755    MyD88-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0002756    MyD88-independent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor not relying on the MyD88 adaptor molecule. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0035666    TRIF-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the TRIF adaptor mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0060071    Wnt signaling pathway, planar cell polarity pathway    The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0031145    anaphase-promoting complex-dependent catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0016197    endosomal transport    The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0005978    glycogen biosynthetic process    The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0036297    interstrand cross-link repair    Removal of a DNA interstrand crosslink (a covalent attachment of DNA bases on opposite strands of the DNA) and restoration of the DNA. DNA interstrand crosslinks occur when both strands of duplex DNA are covalently tethered together (e.g. by an exogenous or endogenous agent), thus preventing the strand unwinding necessary for essential DNA functions such as transcription and replication.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0047497    mitochondrion transport along microtubule    The directed movement of a mitochondrion along a microtubule, mediated by motor proteins.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0042059    negative regulation of epidermal growth factor receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0032480    negative regulation of type I interferon production    Any process that stops, prevents, or reduces the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0051436    negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin ligase activity that contributes to the mitotic cell cycle.
    GO:0048812    neuron projection morphogenesis    The process in which the anatomical structures of a neuron projection are generated and organized. A neuron projection is any process extending from a neural cell, such as axons or dendrites.
    GO:0070423    nucleotide-binding oligomerization domain containing signaling pathway    Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0033683    nucleotide-excision repair, DNA incision    A process that results in the endonucleolytic cleavage of the damaged strand of DNA. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound.
    GO:0006296    nucleotide-excision repair, DNA incision, 5'-to lesion    The endonucleolytic cleavage of the damaged strand of DNA 5' to the site of damage. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound. The incision follows the incision formed 3' to the site of damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0045742    positive regulation of epidermal growth factor receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:1902255    positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator    Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway by p53 class mediator.
    GO:1902527    positive regulation of protein monoubiquitination    Any process that activates or increases the frequency, rate or extent of protein monoubiquitination.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0051881    regulation of mitochondrial membrane potential    Any process that modulates the establishment or extent of the mitochondrial membrane potential, the electric potential existing across the mitochondrial membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0010939    regulation of necrotic cell death    Any process that modulates the rate, frequency or extent of necrotic cell death. Necrotic cell death is a cell death process that is morphologically characterized by a gain in cell volume (oncosis), swelling of organelles, plasma membrane rupture and subsequent loss of intracellular contents.
    GO:1901214    regulation of neuron death    Any process that modulates the frequency, rate or extent of neuron death.
    GO:0061136    regulation of proteasomal protein catabolic process    Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0010803    regulation of tumor necrosis factor-mediated signaling pathway    Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
    GO:0032479    regulation of type I interferon production    Any process that modulates the frequency, rate, or extent of interferon type I production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051403    stress-activated MAPK cascade    A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030666    endocytic vesicle membrane    The lipid bilayer surrounding an endocytic vesicle.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B   (UBB_BOVIN | P0CG53)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (RS27A_CHICK | P79781)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0022627    cytosolic small ribosomal subunit    The small subunit of a ribosome located in the cytosol.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain A,B   (RL40_BOVIN | P63048)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (UBB_MOUSE | P0CG49)
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0060612    adipose tissue development    The process whose specific outcome is the progression of adipose tissue over time, from its formation to the mature structure. Adipose tissue is specialized tissue that is used to store fat.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0097009    energy homeostasis    Any process involved in the balance between food intake (energy input) and energy expenditure.
    GO:0060613    fat pad development    The progression of a fat pad from its initial formation to its mature structure. A fat pad is an accumulation of adipose tissue.
    GO:0008585    female gonad development    The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
    GO:0007144    female meiosis I    The cell cycle process in which the first meiotic division occurs in the female germline.
    GO:0021888    hypothalamus gonadotrophin-releasing hormone neuron development    The process whose specific outcome is the progression of a hypothalamus gonadotrophin-releasing hormone neuron over time, from initial commitment of its fate, to the fully functional differentiated cell.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0007141    male meiosis I    A cell cycle process comprising the steps by which a cell progresses through male meiosis I, the first meiotic division in the male germline.
    GO:0047497    mitochondrion transport along microtubule    The directed movement of a mitochondrion along a microtubule, mediated by motor proteins.
    GO:0048812    neuron projection morphogenesis    The process in which the anatomical structures of a neuron projection are generated and organized. A neuron projection is any process extending from a neural cell, such as axons or dendrites.
    GO:1902255    positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator    Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway by p53 class mediator.
    GO:0051881    regulation of mitochondrial membrane potential    Any process that modulates the establishment or extent of the mitochondrial membrane potential, the electric potential existing across the mitochondrial membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:1901214    regulation of neuron death    Any process that modulates the frequency, rate or extent of neuron death.
    GO:0061136    regulation of proteasomal protein catabolic process    Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
    GO:0072520    seminiferous tubule development    The reproductive developmental process whose specific outcome is the progression of the seminiferous tubule over time, from its formation to the mature structure. Seminiferous tubules are ducts located in the testicles, and are the specific location of meiosis, and the subsequent creation of gametes, namely spermatozoa.
    GO:0010992    ubiquitin recycling    Any process involved in the maintenance of an internal steady state of ubiquitin monomers and free ubiquitin chains at the level of the cell by recycling ubiquitin from proteasome-bound ubiquitinated intermediates.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (RL40_MOUSE | P62984)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (RS27A_RAT | P62982)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0022627    cytosolic small ribosomal subunit    The small subunit of a ribosome located in the cytosol.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (RS27A_CAVPO | P62978)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (UBIQP_CRIGR | P62976)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBB_CHICK | P0CG62)
molecular function
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0060612    adipose tissue development    The process whose specific outcome is the progression of adipose tissue over time, from its formation to the mature structure. Adipose tissue is specialized tissue that is used to store fat.
    GO:0097009    energy homeostasis    Any process involved in the balance between food intake (energy input) and energy expenditure.
    GO:0060613    fat pad development    The progression of a fat pad from its initial formation to its mature structure. A fat pad is an accumulation of adipose tissue.
    GO:0008585    female gonad development    The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
    GO:0007144    female meiosis I    The cell cycle process in which the first meiotic division occurs in the female germline.
    GO:0021888    hypothalamus gonadotrophin-releasing hormone neuron development    The process whose specific outcome is the progression of a hypothalamus gonadotrophin-releasing hormone neuron over time, from initial commitment of its fate, to the fully functional differentiated cell.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0007141    male meiosis I    A cell cycle process comprising the steps by which a cell progresses through male meiosis I, the first meiotic division in the male germline.
    GO:0072520    seminiferous tubule development    The reproductive developmental process whose specific outcome is the progression of the seminiferous tubule over time, from its formation to the mature structure. Seminiferous tubules are ducts located in the testicles, and are the specific location of meiosis, and the subsequent creation of gametes, namely spermatozoa.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
    GO:0010992    ubiquitin recycling    Any process involved in the maintenance of an internal steady state of ubiquitin monomers and free ubiquitin chains at the level of the cell by recycling ubiquitin from proteasome-bound ubiquitinated intermediates.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBIQ_RABIT | P62975)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBC_BOVIN | P0CH28)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBC_MOUSE | P0CG50)
molecular function
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0010992    ubiquitin recycling    Any process involved in the maintenance of an internal steady state of ubiquitin monomers and free ubiquitin chains at the level of the cell by recycling ubiquitin from proteasome-bound ubiquitinated intermediates.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (UBB_CAVPO | P0CG54)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (RL40_RAT | P62986)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0022625    cytosolic large ribosomal subunit    The large subunit of a ribosome located in the cytosol.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (RL40_HUMAN | P62987)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0042769    DNA damage response, detection of DNA damage    The series of events required to receive a stimulus indicating DNA damage has occurred and convert it to a molecular signal.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007249    I-kappaB kinase/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
    GO:0007254    JNK cascade    An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0002755    MyD88-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0002756    MyD88-independent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor not relying on the MyD88 adaptor molecule. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006614    SRP-dependent cotranslational protein targeting to membrane    The targeting of proteins to a membrane that occurs during translation and is dependent upon two key components, the signal-recognition particle (SRP) and the SRP receptor. SRP is a cytosolic particle that transiently binds to the endoplasmic reticulum (ER) signal sequence in a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0035666    TRIF-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the TRIF adaptor mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0060071    Wnt signaling pathway, planar cell polarity pathway    The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0031145    anaphase-promoting complex-dependent catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0016197    endosomal transport    The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0005978    glycogen biosynthetic process    The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0036297    interstrand cross-link repair    Removal of a DNA interstrand crosslink (a covalent attachment of DNA bases on opposite strands of the DNA) and restoration of the DNA. DNA interstrand crosslinks occur when both strands of duplex DNA are covalently tethered together (e.g. by an exogenous or endogenous agent), thus preventing the strand unwinding necessary for essential DNA functions such as transcription and replication.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0042059    negative regulation of epidermal growth factor receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0032480    negative regulation of type I interferon production    Any process that stops, prevents, or reduces the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0051436    negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin ligase activity that contributes to the mitotic cell cycle.
    GO:0000184    nuclear-transcribed mRNA catabolic process, nonsense-mediated decay    The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
    GO:0070423    nucleotide-binding oligomerization domain containing signaling pathway    Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0033683    nucleotide-excision repair, DNA incision    A process that results in the endonucleolytic cleavage of the damaged strand of DNA. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound.
    GO:0006296    nucleotide-excision repair, DNA incision, 5'-to lesion    The endonucleolytic cleavage of the damaged strand of DNA 5' to the site of damage. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound. The incision follows the incision formed 3' to the site of damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0045742    positive regulation of epidermal growth factor receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0010939    regulation of necrotic cell death    Any process that modulates the rate, frequency or extent of necrotic cell death. Necrotic cell death is a cell death process that is morphologically characterized by a gain in cell volume (oncosis), swelling of organelles, plasma membrane rupture and subsequent loss of intracellular contents.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0010803    regulation of tumor necrosis factor-mediated signaling pathway    Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
    GO:0032479    regulation of type I interferon production    Any process that modulates the frequency, rate, or extent of interferon type I production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051403    stress-activated MAPK cascade    A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0019083    viral transcription    The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
    GO:0098792    xenophagy    The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0022625    cytosolic large ribosomal subunit    The large subunit of a ribosome located in the cytosol.
    GO:0030666    endocytic vesicle membrane    The lipid bilayer surrounding an endocytic vesicle.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005765    lysosomal membrane    The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (RS27A_BOVIN | P62992)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain A,B   (UBC_PIG | P0CG68)
molecular function
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
biological process
    GO:0010992    ubiquitin recycling    Any process involved in the maintenance of an internal steady state of ubiquitin monomers and free ubiquitin chains at the level of the cell by recycling ubiquitin from proteasome-bound ubiquitinated intermediates.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1gjz)
 
  Sites
(no "Sites" information available for 1gjz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gjz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1gjz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL40_BOVIN | P63048
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL40_CHICK | P62985
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL40_HUMAN | P62987
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL40_MOUSE | P62984
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL40_PIG | P63053
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RL40_RAT | P62986
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_BOVIN | P62992
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_CAVPO | P62978
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_CHICK | P79781
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_HUMAN | P62979
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_MOUSE | P62983
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RS27A_RAT | P62982
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_BOVIN | P0CG53
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_CAVPO | P0CG54
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_CHICK | P0CG62
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_HUMAN | P0CG47
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_MOUSE | P0CG49
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBB_RAT | P0CG51
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBC_BOVIN | P0CH28
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBC_HUMAN | P0CG48
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBC_MOUSE | P0CG50
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBC_PIG | P0CG68
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/Sw