|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1TAB) |
(no "Site" information available for 1TAB) |
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1TAB) |
Asymmetric Unit (4, 4)
|
Asymmetric Unit (4, 4)
|
Asymmetric UnitChain E from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:223 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 TRY1_BOVIN 24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d1tabe_ E: Trypsin(ogen) SCOP domains CATH domains 1tabE01 1tabE02 E:28-120,E:233-245 Trypsin-like serine proteases 1tabE01 E:16-27,E:121-232 Trypsin-like serine proteases 1tabE02 CATH domains Pfam domains Trypsin-1tabE01 E:16-238 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: E:16-243 UniProt: 24-244 -- PROSITE (1) PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: E:16-63 (gaps) UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: E:151-194 UniProt: 154-199 Exon 1.5 PDB: E:195-245 (gaps) Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.3 PDB: E:63-151 (gaps) UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 1tab E 16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 245 25 37 47 57 67| 78 88 98 108 118 |129|| 140 150 160 170 180 | 188 198 ||212 || 222 232 242 34| 67| 125| || 184A 188A 204| 217| | 37 69 127 || 209 219 | 130| 221A 132 Chain I from PDB Type:PROTEIN Length:36 aligned with IBB1_PHAAN | P01058 from UniProtKB/Swiss-Prot Length:82 Alignment length:62 21 31 41 51 61 71 IBB1_PHAAN 12 SESSKPCCDQCSCTKSMPPKCRCSDIRLNSCHSACKSCACTYSIPAKCFCTDINDFCYEPCK 73 SCOP domains d1tabi_ I: Bowman-Birk inhi bitor, BB SCOP domains CATH domains 1tabI00 I:12-73 CATH domains Pfam domains ------Bowman-Birk_leg-1tabI----------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ----------------------BOWMAN_BIRK ------------------------ PROSITE (2) Transcript -------------------------------------------------------------- Transcript 1tab I 12 SESSKPCCDQCSCTKSMPPKCRCSDIR--------------------------NDFCYEPCK 73 21 31 | - - - | 71 38 65
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain E (TRY1_BOVIN | P00760)
Chain I (IBB1_PHAAN | P01058)
|
|
|
|
|
|
|