|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (6, 6)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1O3I) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1O3I) |
PROSITE Motifs (3, 3)
Asymmetric/Biological Unit (3, 3)
|
||||||||||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:223 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot Length:246 Alignment length:223 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 TRY1_BOVIN 24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 246 SCOP domains d1o3ia_ A: Trypsin(ogen) SCOP domains CATH domains 1o3iA01 1o3iA02 A:28-120,A:233-245 Trypsin-like serine proteases 1o3iA01 A:16-27,A:121-232 Trypsin-like serine proteases 1o3iA02 CATH domains Pfam domains Trypsin-1o3iA01 A:16-238 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: A:16-243 UniProt: 24-244 -- PROSITE (1) PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: A:16-63 (gaps) UniProt: 16-69 ------------------------------------------------------------------------------------Exon 1.4 PDB: A:151-194 UniProt: 154-199 Exon 1.5 PDB: A:195-245 (gaps) Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.3 PDB: A:63-151 (gaps) UniProt: 69-154 -------------------------------------------------------------------------------------------- Transcript 1 (2) 1o3i A 16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 245 25 37 47 57 66| 78 88 98 108 118 |129|| 140 150 160 170 180 | 188A 198 ||212 || 222 232 242 34| 65A|| 125| || 184A 188A 204| 217| | 37 66| 127 || 209 219 | 69 130| 221A 132
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (10, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (TRY1_BOVIN | P00760)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|