1IGY - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:213
 aligned with IGKC_MOUSE | P01837 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:213
                                                                                                                                       1                                                                                                         
                                     -         -         -         -         -         -         -         -         -         -       | 3        13        23        33        43        53        63        73        83        93       103   
           IGKC_MOUSE     - -----------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 106
               SCOP domains d1igya1 A:2-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                d1igya2 A:108-214 Immunoglobulin light chain kappa constant domain, CL-kappa                                SCOP domains
               CATH domains 1igyA01 A:2-108 Immunoglobulins                                                                            1igyA02 A:109-211 Immunoglobulins                                                                      --- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...........eeeeeee.......eeeeee......eeee....eee......eeeeee..eeeeee....hhh..eeeeee...........eeeee.......eeeee...hhhhhh.eeeeeeeee.......eeeee.........eeeee...........eeeeeeeehhhhh...eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ---------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1igy A   2 KCAHTVSKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 214
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain B from PDB  Type:PROTEIN  Length:434
 aligned with IGH1M_MOUSE | P01869 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:434
                                                                                                                                              1                                                                                                                                                                                                                                                                                                                               
                                     -         -         -         -         -         -         -         -         -         -         -    |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316    
          IGH1M_MOUSE     - ------------------------------------------------------------------------------------------------------------------AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH 320
               SCOP domains d1igyb1 B:2-113 Immunoglobulin heavy chain variable domain, VH                                                    d1igyb2 B:114-235 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                       d1igyb3 B:236-361 Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma                                     d1igyb4 B:363-474 Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma                        SCOP domains
               CATH domains 1igyB01 B:2-113 Immunoglobulins                                                                                   1igyB02 B:114-239 Immunoglobulins                                                                         1igyB03 B:240-360 Immunoglobulins                                                                              1igyB04 B:361-474 Immunoglobulins                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...........eeeeeee.........eeeeee.....eeeeeee......eee.hhh...eeeeeehhh.eeeeee....hhh.eeeeeee..........eee..........eeeee...........eeeeeeeeee....eeeee........eee.........eeeeeeeeeehhhhh...eeeeeee....eeeeee...................eeeee..............eeeeeee.........eeeeee.............eee....eeeeeeee..hhhhhh..eeeeeee.......eeeeee.........eeeee..........eeeeeeeee.......eeeeee.......eee............eeeeeeeehhhhh....eeeeee....hhh.eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1igy B   2 VKLQESGAELARPGASVKMSCKASGYTFTTYTIHWIKQRPGQGLEWIGYINPSSVYTNYNQRFKDKATLTRDRSSNTANIHLSSLTSDDSAVYYCVREGEVPYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDTLLITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVHTAQTQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGKPRAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQSDGQAPENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH 474
                                    11        21        31        41        51 |      60        70        80  |||   87        97||     109       119       129||     141       151  |||| 166  ||   177  ||   189      |202       212       222||  || 239     ||252       262       272       282       292|||    306       318       328       338       348      |359 ||    370       382       392       402|  ||||417       427|||    440       450       460       470    
                                                                             52A                            82A||              98|                          130|                  154|||    169|      180|          196|||                  223|  ||       245|                                        292|||            314|                                   355| 361|            378|                  402|  ||||           428||                                         
                                                                                                             82B|              101                           133                   156||     171       183           199||                   226  ||        249                                         295||             317                                    357  363             381                   405  ||||            430|                                         
                                                                                                              82C                                                                   157|                              200|                      229|                                                     296|                                                                                                  408|||             433                                         
                                                                                                                                                                                     162                               202                       235                                                      299                                                                                                   410||                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                 411|                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                  414

Chain C from PDB  Type:PROTEIN  Length:213
 aligned with IGKC_MOUSE | P01837 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:213
                                                                                                                                       1                                                                                                         
                                     -         -         -         -         -         -         -         -         -         -       | 3        13        23        33        43        53        63        73        83        93       103   
           IGKC_MOUSE     - -----------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 106
               SCOP domains d1igyc1 C:2-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                d1igyc2 C:108-214 Immunoglobulin light chain kappa constant domain, CL-kappa                                SCOP domains
               CATH domains 1igyC01 C:2-108 Immunoglobulins                                                                            1igyC02 C:109-211 Immunoglobulins                                                                      --- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...........eeeeeee.......eeeeee......eeee....eee......eeeeee..eeeeee.........eeeeee...........eeeee.......eeeee...hhhhhh.eeeeeeeee.......eeeee.........eeeee...........eeeeeeeehhhhh...eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ---------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1igy C   2 KCAHTVSKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 214
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain D from PDB  Type:PROTEIN  Length:434
 aligned with IGH1M_MOUSE | P01869 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:434
                                                                                                                                              1                                                                                                                                                                                                                                                                                                                               
                                     -         -         -         -         -         -         -         -         -         -         -    |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316    
          IGH1M_MOUSE     - ------------------------------------------------------------------------------------------------------------------AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH 320
               SCOP domains d1igyd1 D:2-113 Immunoglobulin heavy chain variable domain, VH                                                    d1igyd2 D:114-235 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                       d1igyd3 D:236-361 Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma                                     d1igyd4 D:363-474 Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma                        SCOP domains
               CATH domains 1igyD01 D:2-113 Immunoglobulins                                                                                   1igyD02 D:114-239 Immunoglobulins                                                                         1igyD03 D:240-357 Immunoglobulins                                                                           1igyD04 D:358-474 Immunoglobulins                                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...........eeeeeee.........eeeeee.....eeeeeee......eee.hhh...eeeeeehhh.eeeeee....hhh.eeeeeee..........eee..........eeeee...........eeeeeeeeee....eeeee........eee.........eeeeeeeeeehhhhh...eeeeeee....eeeeee...................eeeee...hhhhh......eeeeeee.........eeeeee.............eee....eeeeeeee..hhhhhh..eeeeeee.......eeeeee.........eeeee..........eeeeeeeee.......eeeeee.......eee............eeeeeeeehhhhh....eeeeee....hhh.eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1igy D   2 VKLQESGAELARPGASVKMSCKASGYTFTTYTIHWIKQRPGQGLEWIGYINPSSVYTNYNQRFKDKATLTRDRSSNTANIHLSSLTSDDSAVYYCVREGEVPYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDTLLITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVHTAQTQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGKPRAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQSDGQAPENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH 474
                                    11        21        31        41        51 |      60        70        80  |||   87        97||     109       119       129||     141       151  |||| 166  ||   177  ||   189      |202       212       222||  || 239     ||252       262       272       282       292|||    306       318       328       338       348      |359 ||    370       382       392       402|  ||||417       427|||    440       450       460       470    
                                                                             52A                            82A||              98|                          130|                  154|||    169|      180|          196|||                  223|  ||       245|                                        292|||            314|                                   355| 361|            378|                  402|  ||||           428||                                         
                                                                                                             82B|              101                           133                   156||     171       183           199||                   226  ||        249                                         295||             317                                    357  363             381                   405  ||||            430|                                         
                                                                                                              82C                                                                   157|                              200|                      229|                                                     296|                                                                                                  408|||             433                                         
                                                                                                                                                                                     162                               202                       235                                                      299                                                                                                   410||                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                 411|                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                  414

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C (IGKC_MOUSE | P01837)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0034987	immunoglobulin receptor binding	Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
biological process
	GO:0030183	B cell differentiation	The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0006910	phagocytosis, recognition	The initial step in phagocytosis involving adhesion to bacteria, immune complexes and other particulate matter, or an apoptotic cell and based on recognition of factors such as bacterial cell wall components, opsonins like complement and antibody or protein receptors and lipids like phosphatidyl serine, and leading to intracellular signaling in the phagocytosing cell.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0042571	immunoglobulin complex, circulating	An immunoglobulin complex that is secreted into extracellular space and found in mucosal areas or other tissues or circulating in the blood or lymph. In its canonical form, a circulating immunoglobulin complex is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. Some forms of are polymers of the basic structure and contain additional components such as J-chain and the secretory component.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D (IGH1M_MOUSE | P01869)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0034987	immunoglobulin receptor binding	Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
biological process
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0019731	antibacterial humoral response	An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster.
	GO:0001788	antibody-dependent cellular cytotoxicity	Cytolysis of target cells by natural killer cells, eosinophils, neutrophils, monocytes, or macrophages following engagement of antibodies bound to the target cells by Fc receptors on the effector cells.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0002455	humoral immune response mediated by circulating immunoglobulin	An immune response dependent upon secreted immunoglobulin. An example of this process is found in Mus musculus.
	GO:0016064	immunoglobulin mediated immune response	An immune response mediated by immunoglobulins, whether cell-bound or in solution.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0006910	phagocytosis, recognition	The initial step in phagocytosis involving adhesion to bacteria, immune complexes and other particulate matter, or an apoptotic cell and based on recognition of factors such as bacterial cell wall components, opsonins like complement and antibody or protein receptors and lipids like phosphatidyl serine, and leading to intracellular signaling in the phagocytosing cell.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
	GO:0050778	positive regulation of immune response	Any process that activates or increases the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050766	positive regulation of phagocytosis	Any process that activates or increases the frequency, rate or extent of phagocytosis.
	GO:0001812	positive regulation of type I hypersensitivity	Any process that activates or increases the frequency, rate or extent of type I hypersensitivity, a type of inflammatory response.
	GO:0001798	positive regulation of type IIa hypersensitivity	Any process that activates or increases the frequency, rate or extent of type IIa hypersensitivity, a type of inflammatory response.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0042571	immunoglobulin complex, circulating	An immunoglobulin complex that is secreted into extracellular space and found in mucosal areas or other tissues or circulating in the blood or lymph. In its canonical form, a circulating immunoglobulin complex is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. Some forms of are polymers of the basic structure and contain additional components such as J-chain and the secretory component.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (7, 18)

Sites (15, 15)

SS Bonds (18, 18)

Cis Peptide Bonds (10, 10)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (6, 12)

CATH Domains (1, 12)

Pfam Domains (0, 0)

Gene Ontology (25, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File