1C9T - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Title :   COMPLEX OF BDELLASTASIN WITH BOVINE TRYPSIN

Authors :   U. Rester, W. Bode, M. Moser, M. A. Parry, R. Huber, E. Auerswald

Date :   03 Aug 99 (Deposition) - 03 Aug 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1: A,G  (1x)
Biol. Unit 2: B,H  (1x)
Biol. Unit 3: C,I  (1x)
Biol. Unit 4: D,J  (1x)
Biol. Unit 5: E,K  (1x)
Biol. Unit 6: F,L  (1x)

Keywords :   Complex (Hydrolase/Inhibitor), Hydrolase, Inhibitor, Antistasin, Plasmin, Hydrolase/Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   U. Rester, W. Bode, M. Moser, M. A. Parry, R. Huber, E. Auerswald
Structure Of The Complex Of The Antistasin-Type Inhibitor Bdellastasin With Trypsin And Modelling Of The Bdellastasin-Microplasmin System.
J. Mol. Biol. V. 293 93 1999
PubMed-ID: 10512718 | Reference-DOI: 10.1006/JMBI.1999.3162
(for further references see the PDB file header)

Molecule 1 - TRYPSIN
	Chains	:	A, B, C, D, E, F
	EC Number	:	3.4.21.4
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Secretion	:	SALIVA

Molecule 2 - BDELLASTASIN
	Chains	:	G, H, I, J, K, L
	Engineered	:	YES
	Expression System	:	SACCHAROMYCES CEREVISIAE
	Expression System Common	:	BAKER'S YEAST
	Expression System Taxid	:	4932
	Organism Common	:	MEDICINAL LEECH
	Organism Scientific	:	HIRUDO MEDICINALIS
	Organism Taxid	:	6421

		1	2	3	4	5	6	7	8	9	10	11	12
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J	K	L
Biological Unit 1 (1x)	:	A						G
Biological Unit 2 (1x)	:		B						H
Biological Unit 3 (1x)	:			C						I
Biological Unit 4 (1x)	:				D						J
Biological Unit 5 (1x)	:					E						K
Biological Unit 6 (1x)	:						F						L

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1C9T)

(no "Site" information available for 1C9T)

Asymmetric Unit

No.	Residues
1	A:22	-	A:157
2	A:42	-	A:58
3	A:128	-	A:232
4	A:136	-	A:201
5	A:168	-	A:182
6	A:191	-	A:220
7	B:22	-	B:157
8	B:42	-	B:58
9	B:128	-	B:232
10	B:136	-	B:201
11	B:168	-	B:182
12	B:191	-	B:220
13	C:22	-	C:157
14	C:42	-	C:58
15	C:128	-	C:232
16	C:136	-	C:201
17	C:168	-	C:182
18	C:191	-	C:220
19	D:22	-	D:157
20	D:42	-	D:58
21	D:128	-	D:232
22	D:136	-	D:201
23	D:168	-	D:182
24	D:191	-	D:220
25	E:22	-	E:157
26	E:42	-	E:58
27	E:128	-	E:232
28	E:136	-	E:201
29	E:168	-	E:182
30	E:191	-	E:220
31	F:22	-	F:157
32	F:42	-	F:58
33	F:128	-	F:232
34	F:136	-	F:201
35	F:168	-	F:182
36	F:191	-	F:220
37	G:10	-	G:21
38	G:15	-	G:26
39	G:28	-	G:48
40	G:33	-	G:52
41	G:37	-	G:54
42	H:10	-	H:21
43	H:15	-	H:26
44	H:28	-	H:48
45	H:33	-	H:52
46	H:37	-	H:54
47	I:10	-	I:21
48	I:15	-	I:26
49	I:28	-	I:48
50	I:33	-	I:52
51	I:37	-	I:54
52	J:10	-	J:21
53	J:15	-	J:26
54	J:28	-	J:48
55	J:33	-	J:52
56	J:37	-	J:54
57	K:10	-	K:21
58	K:15	-	K:26
59	K:28	-	K:48
60	K:33	-	K:52
61	K:37	-	K:54
62	L:10	-	L:21
63	L:15	-	L:26
64	L:28	-	L:48
65	L:33	-	L:52
66	L:37	-	L:54

(no "Cis Peptide Bond" information available for 1C9T)

(no "SAP(SNP)/Variant" information available for 1C9T)

Asymmetric Unit (4, 24)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	6	A:16-243 B:16-243 C:16-243 D:16-243 E:16-243 F:16-243
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	6	G:28-54 H:28-54 I:28-54 J:28-54 K:28-54 L:28-54
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	6	A:53-58 B:53-58 C:53-58 D:53-58 E:53-58 F:53-58
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	6	A:189-200 B:189-200 C:189-200 D:189-200 E:189-200 F:189-200

Biological Unit 1 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	A:16-243 - - - - -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	G:28-54 - - - - -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	A:53-58 - - - - -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	A:189-200 - - - - -

Biological Unit 2 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	- B:16-243 - - - -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	- H:28-54 - - - -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	- B:53-58 - - - -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	- B:189-200 - - - -

Biological Unit 3 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	- - C:16-243 - - -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	- - I:28-54 - - -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	- - C:53-58 - - -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	- - C:189-200 - - -

Biological Unit 4 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	- - - D:16-243 - -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	- - - J:28-54 - -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	- - - D:53-58 - -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	- - - D:189-200 - -

Biological Unit 5 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	- - - - E:16-243 -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	- - - - K:28-54 -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	- - - - E:53-58 -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	- - - - E:189-200 -

Biological Unit 6 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	TRY1_BOVIN	24-244	1	- - - - - F:16-243
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	BDEL_HIRME	28-54	1	- - - - - L:28-54
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	TRY1_BOVIN	59-64	1	- - - - - F:53-58
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	TRY1_BOVIN	194-205	1	- - - - - F:189-200

Asymmetric Unit (4, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000033479	1	ENSBTAE00000401279	chr4:109299627-109299547	81	TRY1_BOVIN	1-16	16	0	-	-
1.2	ENSBTAT00000033479	2	ENSBTAE00000397626	chr4:109298170-109298011	160	TRY1_BOVIN	16-69	54	6	A:16-63 (gaps) B:16-63 (gaps) C:16-63 (gaps) D:16-63 (gaps) E:16-63 (gaps) F:16-63 (gaps)	48 48 48 48 48 48
1.3	ENSBTAT00000033479	3	ENSBTAE00000409037	chr4:109297593-109297340	254	TRY1_BOVIN	69-154	86	6	A:63-151 (gaps) B:63-151 (gaps) C:63-151 (gaps) D:63-151 (gaps) E:63-151 (gaps) F:63-151 (gaps)	89 89 89 89 89 89
1.4	ENSBTAT00000033479	4	ENSBTAE00000386782	chr4:109296654-109296518	137	TRY1_BOVIN	154-199	46	6	A:151-194 B:151-194 C:151-194 D:151-194 E:151-194 F:151-194	46 46 46 46 46 46
1.5	ENSBTAT00000033479	5	ENSBTAE00000422174	chr4:109295990-109295749	242	TRY1_BOVIN	200-248	49	6	A:195-245 (gaps) B:195-245 (gaps) C:195-245 (gaps) D:195-245 (gaps) E:195-245 (gaps) F:195-245 (gaps)	52 52 52 52 52 52

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9ta_ A: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tA01     1c9tA02 A:28-120,A:233-245 Trypsin-like serine proteases                                  1c9tA01 A:16-27,A:121-232 Trypsin-like serine proteases                                                     1c9tA02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee..............eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: A:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: A:151-194 UniProt: 154-199     Exon 1.5  PDB: A:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: A:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t A   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain B from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9tb_ B: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tB01     1c9tB02 B:28-120,B:233-245 Trypsin-like serine proteases                                  1c9tB01 B:16-27,B:121-232 Trypsin-like serine proteases                                                     1c9tB02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee..............eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: B:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: B:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: B:151-194 UniProt: 154-199     Exon 1.5  PDB: B:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: B:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t B   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain C from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9tc_ C: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tC01     1c9tC02 C:28-120,C:233-245 Trypsin-like serine proteases                                  1c9tC01 C:16-27,C:121-232 Trypsin-like serine proteases                                                     1c9tC02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: C:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: C:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: C:151-194 UniProt: 154-199     Exon 1.5  PDB: C:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: C:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t C   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain D from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9td_ D: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tD01     1c9tD02 D:28-120,D:233-245 Trypsin-like serine proteases                                  1c9tD01 D:16-27,D:121-232 Trypsin-like serine proteases                                                     1c9tD02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: D:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: D:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: D:151-194 UniProt: 154-199     Exon 1.5  PDB: D:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: D:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t D   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain E from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9te_ E: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tE01     1c9tE02 E:28-120,E:233-245 Trypsin-like serine proteases                                  1c9tE01 E:16-27,E:121-232 Trypsin-like serine proteases                                                     1c9tE02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeeehhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: E:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: E:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: E:151-194 UniProt: 154-199     Exon 1.5  PDB: E:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: E:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t E   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain F from PDB  Type:PROTEIN  Length:223
 aligned with TRY1_BOVIN | P00760 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:223
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243   
          TRY1_BOVIN     24 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  246
               SCOP domains d1c9tf_ F: Trypsin(ogen)                                                                                                                                                                                                        SCOP domains
               CATH domains 1c9tF01     1c9tF02 F:28-120,F:233-245 Trypsin-like serine proteases                                  1c9tF01 F:16-27,F:121-232 Trypsin-like serine proteases                                                     1c9tF02       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeeeee........eeeeehhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: F:16-243 UniProt: 24-244                                                                                                                                                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ----------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: F:16-63 (gaps) UniProt: 16-69  ------------------------------------------------------------------------------------Exon 1.4  PDB: F:151-194 UniProt: 154-199     Exon 1.5  PDB: F:195-245 (gaps)                 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.3  PDB: F:63-151 (gaps) UniProt: 69-154                                        -------------------------------------------------------------------------------------------- Transcript 1 (2)
                1c9t F   16 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN  245
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180   |   188       198     ||212    || 222       232       242   
                                             34|                            67|                                                     125|  ||                                                184A 188A              204|     217| |                         
                                              37                             69                                                      127  ||                                                                        209      219 |                         
                                                                                                                                        130|                                                                                  221A                         
                                                                                                                                         132

Chain G from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9tg_ G: Bdellastasin                               SCOP domains
               CATH domains 1c9tG00 G:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee....eee..eee...eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: G:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t G    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Chain H from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9th_ H: Bdellastasin                               SCOP domains
               CATH domains 1c9tH00 H:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee....eee..eee...eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: H:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t H    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Chain I from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9ti_ I: Bdellastasin                               SCOP domains
               CATH domains 1c9tI00 I:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee....eee..eee...eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: I:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t I    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Chain J from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9tj_ J: Bdellastasin                               SCOP domains
               CATH domains 1c9tJ00 J:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee....eee..eee...eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: J:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t J    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Chain K from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9tk_ K: Bdellastasin                               SCOP domains
               CATH domains 1c9tK00 K:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee...eeee..eeee..eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: K:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t K    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Chain L from PDB  Type:PROTEIN  Length:53
 aligned with BDEL_HIRME | P82107 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:53
                                    16        26        36        46        56   
          BDEL_HIRME      7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
               SCOP domains d1c9tl_ L: Bdellastasin                               SCOP domains
               CATH domains 1c9tL00 L:7-59 Antistasin; domain 1                   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee...eeee..eeee..eee.......eee.....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------ANTISTASIN  PDB: L:28-54   ----- PROSITE (2)
                 Transcript ----------------------------------------------------- Transcript
                1c9t L    7 TTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ   59
                                    16        26        36        46        56

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Trypsin-like serine proteases (1752)

Superfamily: Trypsin-like serine proteases (1752)

Family: Eukaryotic proteases (1343)

Protein domain: Trypsin(ogen) (500)

Cow (Bos taurus) [TaxId: 9913] (392)

1a	d1c9ta_	A:
1b	d1c9tb_	B:
1c	d1c9tc_	C:
1d	d1c9td_	D:
1e	d1c9te_	E:
1f	d1c9tf_	F:

Class: Small proteins (3458)

Fold: Knottins (small inhibitors, toxins, lectins) (761)

Superfamily: Leech antihemostatic proteins (21)

Family: Huristasin-like (7)

Protein domain: Bdellastasin (3)

Medicinal leech (Hirudo medicinalis) [TaxId: 6421] (3)

2a	d1c9tg_	G:
2b	d1c9th_	H:
2c	d1c9ti_	I:
2d	d1c9tj_	J:
2e	d1c9tk_	K:
2f	d1c9tl_	L:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Thrombin, subunit H (1535)

Homologous Superfamily: Trypsin-like serine proteases (1488)

Cattle (Bos taurus) (308)

1a	1c9tA01	A:16-27,A:121-232
1b	1c9tB01	B:16-27,B:121-232
1c	1c9tC01	C:16-27,C:121-232
1d	1c9tD01	D:16-27,D:121-232
1e	1c9tE01	E:16-27,E:121-232
1f	1c9tF01	F:16-27,F:121-232
1g	1c9tA02	A:28-120,A:233-245
1h	1c9tB02	B:28-120,B:233-245
1i	1c9tC02	C:28-120,C:233-245
1j	1c9tD02	D:28-120,D:233-245
1k	1c9tE02	E:28-120,E:233-245
1l	1c9tF02	F:28-120,F:233-245

Architecture: Ribbon (789)

Topology: Antistasin; domain 1 (8)

Homologous Superfamily: Antistasin; domain 1 (8)

Cattle (Bos taurus) (1)

2a	1c9tG00	G:7-59
2b	1c9tH00	H:7-59
2c	1c9tI00	I:7-59
2d	1c9tJ00	J:7-59
2e	1c9tK00	K:7-59
2f	1c9tL00	L:7-59

(no "Pfam Domain" information available for 1C9T)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (TRY1_BOVIN | P00760)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain G,H,I,J,K,L (BDEL_HIRME | P82107)

molecular function
	GO:0004857	enzyme inhibitor activity	Binds to and stops, prevents or reduces the activity of an enzyme.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c9t)

	Sites
(no "Sites" information available for 1c9t)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c9t)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1c9t
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BDEL_HIRME \| P82107
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TRY1_BOVIN \| P00760
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BDEL_HIRME \| P82107
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TRY1_BOVIN \| P00760
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1C9T)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (66, 66)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 24)

Exons (4, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 12)

CATH Domains (2, 18)

Pfam Domains (0, 0)

Gene Ontology (15, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File