Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  MBP-FUSION PROTEIN OF PILA1 FROM C. DIFFICILE R20291 RESIDUES 26-166
 
Authors :  K. H. Piepenbrink, E. J. Sundberg
Date :  19 Jun 14  (Deposition) - 14 Jan 15  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Pilin, T4P, Fusion, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. H. Piepenbrink, G. A. Maldarelli, C. F. Martinez De La Pena, T. C. Dingle, G. L. Mulvey, A. Lee, E. Von Rosenvinge, G. D. Armstrong, M. S. Donnenberg, E. J. Sundberg
Structural And Evolutionary Analyses Show Unique Stabilization Strategies In The Type Iv Pili Of Clostridium Difficile.
Structure V. 23 385 2015
PubMed-ID: 25599642  |  Reference-DOI: 10.1016/J.STR.2014.11.018

(-) Compounds

Molecule 1 - MALTOSE-BINDING PROTEIN, PILIN CHIMERA
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Taxid: 511693
    Fragment: UNP RESIDUES 27-392 (MBP), UNP RESIDUES 35-173 (PILA1)
    Gene: MALE, HMPREF9530_03068, CDR20291_3350
    Organism Scientific: ESCHERICHIA COLI, PEPTOCLOSTRIDIUM DIFFICILE R20291
    Organism Taxid: 562, 645463
    Synonym: MBP, MMBP,PILA1

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (1x): A  
Biological Unit 2 (1x):  B 
Biological Unit 3 (1x):   C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 22)

Asymmetric Unit (2, 22)
No.NameCountTypeFull Name
1MTT3Ligand/IonMALTOTETRAOSE
2TMO19Ligand/IonTRIMETHYLAMINE OXIDE
Biological Unit 1 (2, 9)
No.NameCountTypeFull Name
1MTT1Ligand/IonMALTOTETRAOSE
2TMO8Ligand/IonTRIMETHYLAMINE OXIDE
Biological Unit 2 (2, 6)
No.NameCountTypeFull Name
1MTT1Ligand/IonMALTOTETRAOSE
2TMO5Ligand/IonTRIMETHYLAMINE OXIDE
Biological Unit 3 (2, 7)
No.NameCountTypeFull Name
1MTT1Ligand/IonMALTOTETRAOSE
2TMO6Ligand/IonTRIMETHYLAMINE OXIDE

(-) Sites  (22, 22)

Asymmetric Unit (22, 22)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPRO A:271 , ASN A:272 , LYS A:273 , GLU A:274 , HOH A:1367 , HOH A:1464 , HOH A:1503 , LYS C:179binding site for residue TMO A 1201
02AC2SOFTWAREPRO A:40 , ASP A:41 , LYS A:46binding site for residue TMO A 1202
03AC3SOFTWAREGLY A:13 , HIS A:39 , ASP A:41 , HOH A:1414 , HOH A:1496binding site for residue TMO A 1203
04AC4SOFTWAREALA A:77 , GLU A:78binding site for residue TMO A 1204
05AC5SOFTWAREALA A:82 , ALA A:83 , LYS C:1080binding site for residue TMO A 1205
06AC6SOFTWAREASN A:185 , ALA A:186 , LYS A:219binding site for residue TMO A 1206
07AC7SOFTWARELYS A:1030 , ALA A:1112 , HOH A:1404 , HOH A:1408 , HOH A:1507 , HOH A:1510binding site for residue TMO A 1207
08AC8SOFTWAREMET A:0 , LYS A:1 , ARG C:98 , ASN C:100 , GLY C:101binding site for residue TMO A 1208
09AC9SOFTWAREASP A:14 , LYS A:15 , LYS A:42 , GLU A:44 , GLU A:45 , TRP A:62 , ALA A:63 , ASP A:65 , ARG A:66 , GLU A:111 , GLU A:153 , PRO A:154 , TYR A:155 , PHE A:156 , TRP A:230 , TRP A:340 , TYR A:341 , ARG A:344 , HOH A:1364 , HOH A:1365 , HOH A:1389 , HOH A:1452 , HOH A:1454binding site for residue MTT A 1209
10AD1SOFTWAREARG B:98 , ASN B:100 , GLY B:101binding site for residue TMO B 1201
11AD2SOFTWAREPRO B:271 , LYS B:273 , GLU B:274 , HOH B:1332binding site for residue TMO B 1202
12AD3SOFTWAREGLY B:13 , HIS B:39 , ASP B:41 , HOH B:1410binding site for residue TMO B 1203
13AD4SOFTWAREPRO B:40 , ASP B:41 , LYS B:46 , HOH B:1502binding site for residue TMO B 1204
14AD5SOFTWAREALA B:82 , ALA B:83binding site for residue TMO B 1205
15AD6SOFTWAREASP B:14 , LYS B:15 , GLU B:44 , GLU B:45 , TRP B:62 , ALA B:63 , ASP B:65 , ARG B:66 , GLU B:111 , GLU B:153 , PRO B:154 , TYR B:155 , TRP B:230 , TRP B:340 , TYR B:341 , ARG B:344 , GLU B:1111 , HOH B:1385 , HOH B:1395 , HOH B:1396 , HOH B:1446 , HOH B:1485binding site for residue MTT B 1206
16AD7SOFTWAREARG A:98 , ASN A:100 , GLY A:101 , MET C:0binding site for residue TMO C 1201
17AD8SOFTWARELYS A:179 , PRO C:271 , LYS C:273 , GLU C:274 , HOH C:1357binding site for residue TMO C 1202
18AD9SOFTWAREASP C:41 , LYS C:46binding site for residue TMO C 1203
19AE1SOFTWARELYS A:1080 , HOH A:1328 , ALA C:82 , ALA C:83binding site for residue TMO C 1204
20AE2SOFTWAREGLY C:13 , HIS C:39 , HOH C:1436 , HOH C:1524 , HOH C:1575binding site for residue TMO C 1205
21AE3SOFTWAREASN C:234 , LYS C:297binding site for residue TMO C 1206
22AE4SOFTWAREASP C:14 , LYS C:15 , LYS C:42 , GLU C:44 , GLU C:45 , TRP C:62 , ALA C:63 , ASP C:65 , ARG C:66 , GLU C:111 , GLU C:153 , PRO C:154 , TYR C:155 , TRP C:230 , TRP C:340 , TYR C:341 , ARG C:344 , HOH C:1387 , HOH C:1393 , HOH C:1413 , HOH C:1466 , HOH C:1573 , HOH C:1576binding site for residue MTT C 1207

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TSM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TSM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TSM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TSM)

(-) Exons   (0, 0)

(no "Exon" information available for 4TSM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:505
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eeeee.....hhhhhhhhhhhhhhhhh.eeeee...hhhhhhhhhh.......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee.........hhhhhhhhhhhhhh...........hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....eeeehhhhhhhhhhh...eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhh............eeeeee..eeeeee......eeehhhhhhhhhhhhh...ee.................eeee.eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tsm A    0 MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAASNINKAKVASVESDYSSVKSAALSYYSDTNKIPVTPDGQTGLSVLETYMESLPDKADIGGKYKLIKVGNKLVLQIGTNDEGVTLTEAQSAKLLSDIGENKIYTSVTADNLGNPLTSNTKVDNKVLYIVLIDNTV 1159
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369||    1034      1044      1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154     
                                                                                                                                                                                                                                                                                                                                                                                                            370|                                                                                                                                     
                                                                                                                                                                                                                                                                                                                                                                                                            1026                                                                                                                                     


Chain B from PDB  Type:PROTEIN  Length:512
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee.....hhhhhhhhhhhhhhhhh.eeeee...hhhhhhhhhh.......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee............hhhhhhhhhh....eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhh...eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhh............eeeeee..eeeeee......eeehhhhhhhhhhhhh...ee.................eeee.eeeeee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tsm B    0 MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAASNINKAKVASVESDYSSVKSAALSYYSDTNKIPVTPDGQTGLSVLETYMESLPDKADIGGKYKLIKVGNKLVLQIGTNDEGVTLTEAQSAKLLSDIGENKIYTSVTADNLGNPLTSNTKVDNKVLYIVLIDNTVMDSTKGS 1166
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369||    1034      1044      1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      1164  
                                                                                                                                                                                                                                                                                                                                                                                                            370|                                                                                                                                            
                                                                                                                                                                                                                                                                                                                                                                                                            1026                                                                                                                                            


Chain C from PDB  Type:PROTEIN  Length:512
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee.....hhhhhhhhhhhhhhhhh.eeeee...hhhhhhhhhh.......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee............hhhhhhhhhhh...eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhh...eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhh............eeeeee..eeeeee......eeehhhhhhhhhhhhh...ee.................eeee.eeeeee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tsm C    0 MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAASNINKAKVASVESDYSSVKSAALSYYSDTNKIPVTPDGQTGLSVLETYMESLPDKADIGGKYKLIKVGNKLVLQIGTNDEGVTLTEAQSAKLLSDIGENKIYTSVTADNLGNPLTSNTKVDNKVLYIVLIDNTVMDSTKGS 1166
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369||    1034      1044      1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      1164  
                                                                                                                                                                                                                                                                                                                                                                                                            370|                                                                                                                                            
                                                                                                                                                                                                                                                                                                                                                                                                            1026
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TSM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TSM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TSM)

(-) Gene Ontology  (21, 25)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MTT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TMO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tsm)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tsm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C9YRY2_PEPDR | C9YRY2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  D8A942_ECOMS | D8A942
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MALE_ECOLI | P0AEX9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C9YRY2_PEPDR | C9YRY2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  D8A942_ECOMS | D8A942
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MALE_ECOLI | P0AEX9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        D8A942_ECOMS | D8A942: 2xz3 4ogm
        MALE_ECOLI | P0AEX9: 1a7l 1anf 1dmb 1ez9 1ezo 1ezp 1fqa 1fqb 1fqc 1fqd 1hsj 1iud 1jvx 1jvy 1jw4 1jw5 1lax 1lls 1mdp 1mdq 1mg1 1mh3 1mh4 1mpb 1mpc 1mpd 1n3w 1n3x 1nl5 1nmu 1omp 1peb 1r6z 1svx 1t0k 1y4c 1ytv 1ziu 1zjl 1zkb 1zmg 2d21 2h25 2klf 2mv0 2n44 2n45 2nvu 2obg 2ok2 2r6g 2v93 2vgq 2xz3 2zxt 3a3c 3c4m 3csb 3csg 3d4c 3d4g 3dm0 3ef7 3ehs 3eht 3ehu 3f5f 3g7v 3g7w 3h3g 3h4z 3hpi 3hst 3io4 3io6 3ior 3iot 3iou 3iov 3iow 3j9p 3kjt 3l2j 3lbs 3lc8 3mbp 3mp1 3mp6 3mp8 3mq9 3n94 3o3u 3oai 3osq 3osr 3pgf 3puv 3puw 3pux 3puy 3puz 3pv0 3py7 3q25 3q26 3q27 3q28 3q29 3rlf 3rum 3ser 3ses 3set 3seu 3sev 3sew 3sex 3sey 3vfj 3w15 3wai 3woa 4b3n 4bl8 4bl9 4bla 4blb 4bld 4dxb 4dxc 4edq 4egc 4exk 4fe8 4feb 4fec 4fed 4giz 4gli 4ifp 4ikm 4irl 4jbz 4jkm 4keg 4khz 4ki0 4kv3 4kyc 4kyd 4kye 4log 4mbp 4n4x 4ndz 4o2x 4ogm 4pe2 4qsz 4qvh 4r0y 4rg5 4rwf 4rwg 4wjv 4wms 4wmt 4wmu 4wmv 4wmw 4wmx 4wrn 4wth 4wvh 4xa2 4xhs 4xr8 4xzs 4xzv 5aq9 5az6 5az7 5az8 5az9 5aza 5b3w 5b3x 5b3y 5b3z 5c7r 5cbn 5cfv 5dfm 5dis 5e24 5edu 5fio 5fsg 5gru 5gs2 5h7n 5h7q 5hz7 5hzv 5hzw 5i04 5i69 5ihj 5ii5 5iic 5iqz 5jj4 5jst 5jtq 5jtr 5ldf 5t03 5t05 5t0a 5ttd 5wpz 5wq6
UniProtKB/TrEMBL
        D8A942_ECOMS | D8A942: 3ob4 4h1g

(-) Related Entries Specified in the PDB File

4ogm ANALOGOUS PILA1 FROM DIFFERENT STRAIN OF C. DIFFICILE
4pe2 ANALOGOUS PILA1 FROM DIFFERENT STRAIN OF C. DIFFICILE