3A5O - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A DICTYOSTELIUM P109I CA2+-ACTIN IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1

Authors :   K. Murakami, T. Yasunaga, T. Q. Noguchi, T. Q. Uyeda, T. Wakabayashi

Date :   09 Aug 09 (Deposition) - 27 Oct 10 (Release) - 27 Oct 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym./Biol. Unit : C,S

Keywords :   Actin, Adp, Hydrolysis, Actin Capping, Actin-Binding, Cytoskeleton, Atp-Binding, Nucleotide-Binding, Structural Protein, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Murakami, T. Yasunaga, T. Q. P. Noguchi, Y. Gomibuchi, K. X. Ngo, T. Q. P. Uyeda, T. Wakabayashi
Structural Basis For Actin Assembly, Activation Of Atp Hydrolysis, And Delayed Phosphate Release
Cell(Cambridge, Mass. ) V. 143 275 2010
PubMed-ID: 20946985 | Reference-DOI: 10.1016/J.CELL.2010.09.034

Molecule 1 - GELSOLIN
	Chains	:	S
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PEIKL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	GELSOLIN-LIKE 1, RESIDUES 53-176
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ACTIN-DEPOLYMERIZING FACTOR, ADF, BREVIN, AGEL

Molecule 2 - MAJOR ACTIN
	Chains	:	C
	Engineered	:	YES
	Expression System	:	DICTYOSTELIUM
	Expression System Taxid	:	5782
	Expression System Vector Type	:	PLASMID
	Mutation	:	YES
	Organism Common	:	SLIME MOLD
	Organism Scientific	:	DICTYOSTELIUM DISCOIDEUM
	Organism Taxid	:	44689
	Synonym	:	ACTIN-1, ACTIN-2, ACTIN-2-SUB 1, ACTIN-4, ACTIN-5, ACTIN-6, ACTIN-7, ACTIN-8, ACTIN A8, ACTIN-IEL1, ACTIN-9, ACTIN-11, ACTIN-12, ACTIN A12, ACTIN-13, ACTIN-14, ACTIN-15, ACTIN A1, ACTIN III, ACTIN- 3A, ACTIN-16, ACTIN M6, ACTIN-19, ACTIN-20, ACTIN-21

		1	2
Asymmetric/Biological Unit	:	C	S

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 5)

No.	Name	Count	Type	Full Name
1	ATP	1	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	3	Ligand/Ion	CALCIUM ION
3	HIC	1	Mod. Amino Acid	4-METHYL-HISTIDINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY S:43 , ASP S:44 , GLU S:75 , VAL S:123 , HOH S:1031 , HOH S:1117	BINDING SITE FOR RESIDUE CA S 128
2	AC2	SOFTWARE	GLU C:167 , HOH C:1223 , ASP S:87 , GLY S:92 , ALA S:94 , HOH S:1004 , HOH S:1082	BINDING SITE FOR RESIDUE CA S 129
3	AC3	SOFTWARE	ATP C:376 , HOH C:1001 , HOH C:1008 , HOH C:1050 , HOH C:1065 , HOH C:1108	BINDING SITE FOR RESIDUE CA C 377
4	AC4	SOFTWARE	GLY C:13 , SER C:14 , GLY C:15 , MET C:16 , LYS C:18 , GLY C:156 , ASP C:157 , GLY C:158 , VAL C:159 , GLY C:182 , ARG C:210 , LYS C:213 , GLU C:214 , GLY C:301 , GLY C:302 , THR C:303 , MET C:305 , PHE C:306 , CA C:377 , HOH C:1009 , HOH C:1065 , HOH C:1108 , HOH C:1134 , HOH C:1164 , HOH C:1222 , HOH C:1294 , HOH C:1305	BINDING SITE FOR RESIDUE ATP C 376

(no "SS Bond" information available for 3A5O)

(no "Cis Peptide Bond" information available for 3A5O)

Asymmetric/Biological Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024690	A	129	T	GELS_HUMAN	Polymorphism	2230287	S	A	80	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACTINS_1	PS00406	Actins signature 1.	ACT1_DICDI	54-64	1	C:53-63
2	ACTINS_ACT_LIKE	PS01132	Actins and actin-related proteins signature.	ACT1_DICDI	105-117	1	C:104-116
3	ACTINS_2	PS00432	Actins signature 2.	ACT1_DICDI	357-365	1	C:356-364

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.14	ENST00000373818	14	ENSE00001461665	chr9:124062071-124062283	213	GELS_HUMAN	1-48	48	0	-	-
1.16d	ENST00000373818	16d	ENSE00001725493	chr9:124064241-124064445	205	GELS_HUMAN	49-117	69	1	S:5-68	64
1.17	ENST00000373818	17	ENSE00001745162	chr9:124065189-124065343	155	GELS_HUMAN	117-168	52	1	S:68-119	52
1.18b	ENST00000373818	18b	ENSE00001764209	chr9:124072962-124073123	162	GELS_HUMAN	169-222	54	1	S:120-127	8
1.18f	ENST00000373818	18f	ENSE00001689299	chr9:124074617-124074766	150	GELS_HUMAN	223-272	50	0	-	-
1.18i	ENST00000373818	18i	ENSE00001727906	chr9:124076212-124076301	90	GELS_HUMAN	273-302	30	0	-	-
1.19b	ENST00000373818	19b	ENSE00001732099	chr9:124079364-124079496	133	GELS_HUMAN	303-347	45	0	-	-
1.20	ENST00000373818	20	ENSE00001734404	chr9:124080684-124080772	89	GELS_HUMAN	347-376	30	0	-	-
1.21a	ENST00000373818	21a	ENSE00001618926	chr9:124080943-124081158	216	GELS_HUMAN	377-448	72	0	-	-
1.22b	ENST00000373818	22b	ENSE00001591416	chr9:124083546-124083679	134	GELS_HUMAN	449-493	45	0	-	-
1.23	ENST00000373818	23	ENSE00001735249	chr9:124086832-124086922	91	GELS_HUMAN	493-523	31	0	-	-
1.24a	ENST00000373818	24a	ENSE00001704432	chr9:124088790-124088960	171	GELS_HUMAN	524-580	57	0	-	-
1.25	ENST00000373818	25	ENSE00001668309	chr9:124089586-124089760	175	GELS_HUMAN	581-639	59	0	-	-
1.26b	ENST00000373818	26b	ENSE00001721539	chr9:124091169-124091293	125	GELS_HUMAN	639-680	42	0	-	-
1.26c	ENST00000373818	26c	ENSE00001771020	chr9:124091516-124091593	78	GELS_HUMAN	681-706	26	0	-	-
1.27a	ENST00000373818	27a	ENSE00001779366	chr9:124093666-124093726	61	GELS_HUMAN	707-727	21	0	-	-
1.28d	ENST00000373818	28d	ENSE00001732346	chr9:124094712-124095120	409	GELS_HUMAN	727-782	56	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain C from PDB  Type:PROTEIN  Length:367
 aligned with ACT1_DICDI | P07830 from UniProtKB/Swiss-Prot  Length:376

    Alignment length:370
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376
           ACT1_DICDI     7 QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
               SCOP domains d3a5oc1 C:6-146 automated matches                                                                                                            d3a5oc2 C:147-375 automated matches                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...eeeeee.......eeee..eeee........---...eehhhhhhh...eeee..ee..ee.hhhhhhhhhhhhhhh....hhhhh.eeeee....hhhhhhhhhhhhhhh....eeeeeehhhhhhhhh....eeeeee....eeeeeee..ee.hhhheee..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh....hhhhhhhhhhhh....eeee.....eeee.hhhhhhhhhhhhhhhhh....hhhhhhhhhhhh....hhhhhhh.eeeehhhhh..hhhhhhhhhhhhhh.......ee.hhhhhhhhhhhhhhhhhh.hhhhh.eehhhhhhhh..hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------ACTINS_1   ----------------------------------------ACTINS_ACT_LI-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACTINS_2 ----------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3a5o C   6 QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVG---KDSYVGDEAQSKRGILTLKYPIEhGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
                                    15        25        35        45|   |   55        65       |75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375
                                                                   46  50                     73-HIC

Chain S from PDB  Type:PROTEIN  Length:123
 aligned with GELS_HUMAN | P06396 from UniProtKB/Swiss-Prot  Length:782

    Alignment length:123
                                    63        73        83        93       103       113       123       133       143       153       163       173   
           GELS_HUMAN    54 VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF 176
               SCOP domains d3a5os_ S: Gelsolin                                                                                                         SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh....eeeeeeee..eeee.hhhhh.eee...eeeeeeeee.....eeeeeeeee....hhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhh......eee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------T----------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16d  PDB: S:5-68 UniProt: 49-117 [INCOMPLETE]            ---------------------------------------------------1.18b    Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.17  PDB: S:68-119 UniProt: 117-168           -------- Transcript 1 (2)
                 3a5o S   5 VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF 127
                                    14        24        34        44        54        64        74        84        94       104       114       124

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3A5O)

(no "Pfam Domain" information available for 3A5O)

Asymmetric/Biological Unit(hide GO term definitions)

Chain C (ACT1_DICDI | P07830)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0017022	myosin binding	Interacting selectively and non-covalently with any part of a myosin complex; myosins are any of a superfamily of molecular motor proteins that bind to actin and use the energy of ATP hydrolysis to generate force and movement along actin filaments.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0006972	hyperosmotic response	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of detection of, or exposure to, a hyperosmotic environment, i.e. an environment with a higher concentration of solutes than the organism or cell.
	GO:0044351	macropinocytosis	An endocytosis process that results in the uptake of liquid material by cells from their external environment by the 'ruffling' of the cell membrane to form heterogeneously sized intracellular vesicles called macropinosomes, which can be up to 5 micrometers in size.
	GO:0000281	mitotic cytokinesis	A cell cycle process that results in the division of the cytoplasm of a cell after mitosis, resulting in the separation of the original cell into two daughter cells.
	GO:0006909	phagocytosis	An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
	GO:0042331	phototaxis	The directed movement of a motile cell or organism in response to light.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0031252	cell leading edge	The area of a motile cell closest to the direction of movement.
	GO:0060187	cell pole	Either of two different areas at opposite ends of an axis of a cell.
	GO:0044291	cell-cell contact zone	Extended zone of intimate apposition between two cells containing one or more types of intercellular junctions, e.g., the intercalated disk of muscle.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0032009	early phagosome	A membrane-bounded intracellular vesicle as initially formed upon the ingestion of particulate material by phagocytosis.
	GO:0001891	phagocytic cup	An invagination of the cell membrane formed by an actin dependent process during phagocytosis. Following internalization it is converted into a phagosome.
	GO:0045335	phagocytic vesicle	A membrane-bounded intracellular vesicle that arises from the ingestion of particulate material by phagocytosis.
	GO:0032010	phagolysosome	A membrane-bounded intracellular vesicle formed by maturation of an early phagosome following the ingestion of particulate material by phagocytosis; during maturation, phagosomes acquire markers of late endosomes and lysosomes.
	GO:0031143	pseudopodium	A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.

Chain S (GELS_HUMAN | P06396)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0045159	myosin II binding	Interacting selectively and non-covalently with a class II myosin, any member of the class of 'conventional' double-headed myosins that includes muscle myosin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030041	actin filament polymerization	Assembly of actin filaments by the addition of actin monomers to a filament.
	GO:0090527	actin filament reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of actin filaments.
	GO:0051014	actin filament severing	The process in which an actin filament is broken down into smaller filaments.
	GO:0045010	actin nucleation	The initial step in the formation of an actin filament, in which actin monomers combine to form a new filament. Nucleation is slow relative to the subsequent addition of more monomers to extend the filament.
	GO:0008154	actin polymerization or depolymerization	Assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:1990000	amyloid fibril formation	The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins. An example of this is seen when human RIP1 and RIP3 kinases form a heterodimeric functional amyloid signaling complex (PMID:22817896).
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0051016	barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0071276	cellular response to cadmium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0060271	cilium assembly	The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0097284	hepatocyte apoptotic process	Any apoptotic process in a hepatocyte, the main structural component of the liver.
	GO:0046597	negative regulation of viral entry into host cell	Any process that stops, prevents, or reduces the frequency, rate or extent of the entry of viral entry into a host cell.
	GO:0014003	oligodendrocyte development	The process aimed at the progression of an oligodendrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An oligodendrocyte is a type of glial cell involved in myelinating the axons in the central nervous system.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0051127	positive regulation of actin nucleation	Any process that activates or increases the frequency, rate or extent of actin nucleation, the initial step in the formation of an actin filament in which actin monomers combine to form a new filament.
	GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1902174	positive regulation of keratinocyte apoptotic process	Any process that activates or increases the frequency, rate or extent of keratinocyte apoptotic process.
	GO:1903923	positive regulation of protein processing in phagocytic vesicle	Any process that activates or increases the frequency, rate or extent of protein processing in phagocytic vesicle.
	GO:0031648	protein destabilization	Any process that decreases the stability of a protein, making it more vulnerable to degradative processes or aggregation.
	GO:0030155	regulation of cell adhesion	Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
	GO:1903903	regulation of establishment of T cell polarity	Any process that modulates the frequency, rate or extent of establishment of T cell polarity.
	GO:1903906	regulation of plasma membrane raft polarization	Any process that modulates the frequency, rate or extent of plasma membrane raft polarization.
	GO:0071801	regulation of podosome assembly	Any process that modulates the frequency, rate or extent of podosome assembly.
	GO:1903909	regulation of receptor clustering	Any process that modulates the frequency, rate or extent of receptor clustering.
	GO:1903689	regulation of wound healing, spreading of epidermal cells	Any process that modulates the frequency, rate or extent of wound healing, spreading of epidermal cells.
	GO:0097017	renal protein absorption	A renal system process in which proteins are taken up from the collecting ducts, glomerulus and proximal and distal loops of the nephron. In non-mammalian species, absorption may occur in related structures (e.g. protein absorption is observed in nephrocytes in Drosophila, see PMID:23264686).
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0051593	response to folic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a folic acid stimulus.
	GO:0042989	sequestering of actin monomers	The selective interaction of actin monomers with specific molecules that inhibit their polymerization by preventing their access to other monomers.
	GO:0014891	striated muscle atrophy	A process, occurring in striated muscle, that is characterized by a decrease in protein content, fiber diameter, force production and fatigue resistance in response to different conditions such as starvation, aging and disuse.
	GO:0042246	tissue regeneration	The regrowth of lost or destroyed tissues.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0030478	actin cap	Polarized accumulation of cytoskeletal proteins (including F-actin) and regulatory proteins in a cell. An example of this is the actin cap found in Saccharomyces cerevisiae.
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0002102	podosome	An actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell, contain an F-actin-rich core surrounded by a ring structure containing proteins such as vinculin and talin, and have a diameter of 0.5 mm.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0016528	sarcoplasm	The cytoplasm of a muscle cell; includes the sarcoplasmic reticulum.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ATP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HIC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3a5o)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3a5o
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACT1_DICDI \| P07830
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GELS_HUMAN \| P06396
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACT1_DICDI \| P07830
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GELS_HUMAN \| P06396
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1c0f	DICTYOSTELIUM CAATP-ACTIN IN COMPLEX WITH GELSOLIN SEGMENT 1
3a5l	A DICTYOSTELIUM P109A MG2+-ACTIN IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1
3a5m	A DICTYOSTELIUM P109I MG2+-ACTIN IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1
3a5n	A DICTYOSTELIUM P109A CA2+-ACTIN IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 5)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (3, 3)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (87, 93)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File