2FH2 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   C-TERMINAL HALF OF GELSOLIN SOAKED IN EGTA AT PH 4.5

Authors :   S. Chumnarnsilpa, A. Loonchanta, B. Xue, H. Choe, D. Urosev, H. Wang, L. D. Burtnick, R. C. Robinson

Date :   23 Dec 05 (Deposition) - 13 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Gelsolin, Egta, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Chumnarnsilpa, A. Loonchanta, B. Xue, H. Choe, D. Urosev, H. Wang, U. Lindberg, L. D. Burtnick, R. C. Robinson
Calcium Ion Exchange In Crystalline Gelsolin
J. Mol. Biol. V. 357 773 2006
PubMed-ID: 16466744 | Reference-DOI: 10.1016/J.JMB.2006.01.026
(for further references see the PDB file header)

Molecule 1 - GELSOLIN
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PGEX-6P-1
	Expression System Strain	:	XL1 BLUE
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TERMINAL HALF DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ACTIN-DEPOLYMERIZING FACTOR, ADF, BREVIN, AGEL

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 8)

No.	Name	Count	Type	Full Name
1	CA	8	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:444 , ASP A:445 , GLU A:475 , THR A:524 , HOH A:5003 , HOH A:5004	BINDING SITE FOR RESIDUE CA A 1001
2	AC2	SOFTWARE	ASN A:564 , ASP A:565 , GLU A:587 , HOH A:5020 , HOH A:5021	BINDING SITE FOR RESIDUE CA A 1002
3	AC3	SOFTWARE	HOH A:129 , ASP A:669 , ASP A:670 , GLU A:692 , HOH A:5034 , HOH A:5035	BINDING SITE FOR RESIDUE CA A 1003
4	AC4	SOFTWARE	GLY B:444 , ASP B:445 , GLU B:475 , THR B:524 , HOH B:5046	BINDING SITE FOR RESIDUE CA B 2001
5	AC5	SOFTWARE	ASN B:564 , ASP B:565 , GLU B:587 , HOH B:5059 , HOH B:5060	BINDING SITE FOR RESIDUE CA B 2002
6	AC6	SOFTWARE	ASP B:669 , ASP B:670 , GLU B:692 , HOH B:5072	BINDING SITE FOR RESIDUE CA B 2003
7	AC7	SOFTWARE	GLY C:444 , ASP C:445 , GLU C:475 , THR C:524 , HOH C:5085	BINDING SITE FOR RESIDUE CA C 3001
8	AC8	SOFTWARE	ASN C:564 , ASP C:565 , GLU C:587 , HOH C:5098 , HOH C:5100	BINDING SITE FOR RESIDUE CA C 3002

(no "SS Bond" information available for 2FH2)

(no "Cis Peptide Bond" information available for 2FH2)

Asymmetric Unit (2, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036339	S	611	N	GELS_HUMAN	Unclassified	---	A/B/C	S	584	N
2	UniProt	VAR_033958	R	668	L	GELS_HUMAN	Polymorphism	9696578	A/B/C	R	641	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036339	S	611	N	GELS_HUMAN	Unclassified	---	A	S	584	N
2	UniProt	VAR_033958	R	668	L	GELS_HUMAN	Polymorphism	9696578	A	R	641	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036339	S	611	N	GELS_HUMAN	Unclassified	---	B	S	584	N
2	UniProt	VAR_033958	R	668	L	GELS_HUMAN	Polymorphism	9696578	B	R	641	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036339	S	611	N	GELS_HUMAN	Unclassified	---	C	S	584	N
2	UniProt	VAR_033958	R	668	L	GELS_HUMAN	Polymorphism	9696578	C	R	641	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2FH2)

Asymmetric Unit (9, 27)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.14	ENST00000373818	14	ENSE00001461665	chr9:124062071-124062283	213	GELS_HUMAN	1-48	48	0	-	-
1.16d	ENST00000373818	16d	ENSE00001725493	chr9:124064241-124064445	205	GELS_HUMAN	49-117	69	0	-	-
1.17	ENST00000373818	17	ENSE00001745162	chr9:124065189-124065343	155	GELS_HUMAN	117-168	52	0	-	-
1.18b	ENST00000373818	18b	ENSE00001764209	chr9:124072962-124073123	162	GELS_HUMAN	169-222	54	0	-	-
1.18f	ENST00000373818	18f	ENSE00001689299	chr9:124074617-124074766	150	GELS_HUMAN	223-272	50	0	-	-
1.18i	ENST00000373818	18i	ENSE00001727906	chr9:124076212-124076301	90	GELS_HUMAN	273-302	30	0	-	-
1.19b	ENST00000373818	19b	ENSE00001732099	chr9:124079364-124079496	133	GELS_HUMAN	303-347	45	0	-	-
1.20	ENST00000373818	20	ENSE00001734404	chr9:124080684-124080772	89	GELS_HUMAN	347-376	30	0	-	-
1.21a	ENST00000373818	21a	ENSE00001618926	chr9:124080943-124081158	216	GELS_HUMAN	377-448	72	3	A:412-421 B:414-421 C:414-421	10 8 8
1.22b	ENST00000373818	22b	ENSE00001591416	chr9:124083546-124083679	134	GELS_HUMAN	449-493	45	3	A:422-466 B:422-466 (gaps) C:422-466 (gaps)	45 45 45
1.23	ENST00000373818	23	ENSE00001735249	chr9:124086832-124086922	91	GELS_HUMAN	493-523	31	3	A:466-496 B:466-496 C:466-496	31 31 31
1.24a	ENST00000373818	24a	ENSE00001704432	chr9:124088790-124088960	171	GELS_HUMAN	524-580	57	3	A:497-553 B:497-553 C:497-553	57 57 57
1.25	ENST00000373818	25	ENSE00001668309	chr9:124089586-124089760	175	GELS_HUMAN	581-639	59	3	A:554-612 B:554-612 C:554-612	59 59 59
1.26b	ENST00000373818	26b	ENSE00001721539	chr9:124091169-124091293	125	GELS_HUMAN	639-680	42	3	A:612-653 (gaps) B:612-653 C:612-653	42 42 42
1.26c	ENST00000373818	26c	ENSE00001771020	chr9:124091516-124091593	78	GELS_HUMAN	681-706	26	3	A:654-679 B:654-679 C:654-679	26 26 26
1.27a	ENST00000373818	27a	ENSE00001779366	chr9:124093666-124093726	61	GELS_HUMAN	707-727	21	3	A:680-700 B:680-700 C:680-700	21 21 21
1.28d	ENST00000373818	28d	ENSE00001732346	chr9:124094712-124095120	409	GELS_HUMAN	727-782	56	3	A:700-741 (gaps) B:700-741 C:700-741	42 42 42

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:321
 aligned with GELS_HUMAN | P06396 from UniProtKB/Swiss-Prot  Length:782

    Alignment length:330
                                   448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768
           GELS_HUMAN   439 MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYW 768
               SCOP domains d2fh2a1 A:412-532 Gelsolin                                                                                               d2fh2a2 A:533-628 Gelsolin                                                                      d2fh2a3   A:629-741 Gelsolin                                                                                      SCOP domains
               CATH domains 2fh2A01 A:412-532 Severin                                                                                                2fh2A02 A:533-627 Severin                                                                      -2fh2A03   A:629-741 Severin                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeee..eeee.hhhhh.eee...eeeeeeeeee..eeeeeeeeee....hhhhhhhhhhhhhhhhhhh....eeeeee....hhhhhhh.....eeee................eeeeeee.....eeeeee..hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhhh...eeee....hhhhhhhh........hhhhhh...--...eeeeee......eeeee....hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhhhhh.-------..eeeee....hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------------------------------------------L---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.21aExon 1.22b  PDB: A:422-466 UniProt: 449-493  ------------------------------Exon 1.24a  PDB: A:497-553 UniProt: 524-580              Exon 1.25  PDB: A:554-612 UniProt: 581-639                 -----------------------------------------Exon 1.26c  PDB: A:654-679Exon 1.27a           ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.23  PDB: A:466-496      -------------------------------------------------------------------------------------------------------------------Exon 1.26b  PDB: A:612-653 (gaps)         ----------------------------------------------Exon 1.28d  PDB: A:700-741 (gaps)          Transcript 1 (2)
                 2fh2 A 412 MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKM--HPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETD-------TPITVVKQGFEPPSFVGWFLGWDDDYW 741
                                   421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631   |  |641       651       661       671       681       691       701     |   -   |   721       731       741
                                                                                                                                                                                                                                                         635  |                                                                  707     715                          
                                                                                                                                                                                                                                                            638

Chain B from PDB  Type:PROTEIN  Length:324
 aligned with GELS_HUMAN | P06396 from UniProtKB/Swiss-Prot  Length:782

    Alignment length:328
                                   450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760        
           GELS_HUMAN   441 DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYW 768
               SCOP domains d2fh2b1 B:414-532 Gelsolin                                                                                             d2fh2b2 B:533-628 Gelsolin                                                                      d2fh2b3 B:629-741 Gelsolin                                                                                        SCOP domains
               CATH domains 2fh2B01 B:414-532 Severin                                                                                              2fh2B02 B:533-627 Severin                                                                      -2fh2B03 B:629-741 Severin                                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeee..eeee.hhhhh.eee...eeeeeee..----..eeeeeee....hhhhhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhh...eeee................eeeeeee.....eeeeee..hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhh....eeee....hhhhhhhh........hhhhhh........eeeeee......eeee.....hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhhhhh..........eeeee....hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------------------------------------------L---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.21a   Exon 1.22b  PDB: B:422-466 (gaps)            ------------------------------Exon 1.24a  PDB: B:497-553 UniProt: 524-580              Exon 1.25  PDB: B:554-612 UniProt: 581-639                 -----------------------------------------Exon 1.26c  PDB: B:654-679Exon 1.27a           ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.23  PDB: B:466-496      -------------------------------------------------------------------------------------------------------------------Exon 1.26b  PDB: B:612-653                ----------------------------------------------Exon 1.28d  PDB: B:700-741 [INCOMPLETE]    Transcript 1 (2)
                 2fh2 B 414 DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYR----QGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYW 741
                                   423       433       443       453|    | 463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733        
                                                                  454  459

Chain C from PDB  Type:PROTEIN  Length:322
 aligned with GELS_HUMAN | P06396 from UniProtKB/Swiss-Prot  Length:782

    Alignment length:328
                                   450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760        
           GELS_HUMAN   441 DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYW 768
               SCOP domains d2fh2c1 C:414-532 Gelsolin                                                                                             d2fh2c2 C:533-628 Gelsolin                                                                      d2fh2c3 C:629-741 Gelsolin                                                                                        SCOP domains
               CATH domains 2fh2C01 C:414-532 Severin                                                                                              2fh2C02 C:533-627 Severin                                                                      -2fh2C03 C:629-741 Severin                                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeee..eeee.hhhhh.eee...eeeeee..------..eeeeee....hhhhhhhhhhhhhhhhhhhh...eeeeee....hhhhhhhhh...eeee................eeeeeee.....eeeeee..hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhh....eeee....hhhhhhhh........hhhhhh........eeeeee......eeeee....hhhhh....eeeee....eeeee....hhhhhhhhhhhhhhhhh.hhhhh.....eeeee....hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------------------------------------------L---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.21a   Exon 1.22b  PDB: C:422-466 (gaps)            ------------------------------Exon 1.24a  PDB: C:497-553 UniProt: 524-580              Exon 1.25  PDB: C:554-612 UniProt: 581-639                 -----------------------------------------Exon 1.26c  PDB: C:654-679Exon 1.27a           ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.23  PDB: C:466-496      -------------------------------------------------------------------------------------------------------------------Exon 1.26b  PDB: C:612-653                ----------------------------------------------Exon 1.28d  PDB: C:700-741 [INCOMPLETE]    Transcript 1 (2)
                 2fh2 C 414 DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY------GQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYW 741
                                   423       433       443       453      |463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733        
                                                                 453    460

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Gelsolin-like (96)

Superfamily: Actin depolymerizing proteins (88)

Family: Gelsolin-like (43)

Protein domain: Gelsolin (33)

Human (Homo sapiens) [TaxId: 9606] (31)

1a	d2fh2a1	A:412-532
1b	d2fh2a2	A:533-628
1c	d2fh2a3	A:629-741
1d	d2fh2b1	B:414-532
1e	d2fh2b2	B:533-628
1f	d2fh2b3	B:629-741
1g	d2fh2c1	C:414-532
1h	d2fh2c2	C:533-628
1i	d2fh2c3	C:629-741

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Severin (74)

Homologous Superfamily: Severin (74)

Human (Homo sapiens) (36)

1a	2fh2B01	B:414-532
1b	2fh2C01	C:414-532
1c	2fh2A01	A:412-532
1d	2fh2B03	B:629-741
1e	2fh2C03	C:629-741
1f	2fh2A03	A:629-741
1g	2fh2A02	A:533-627
1h	2fh2B02	B:533-627
1i	2fh2C02	C:533-627

(no "Pfam Domain" information available for 2FH2)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (GELS_HUMAN | P06396)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0045159	myosin II binding	Interacting selectively and non-covalently with a class II myosin, any member of the class of 'conventional' double-headed myosins that includes muscle myosin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030041	actin filament polymerization	Assembly of actin filaments by the addition of actin monomers to a filament.
	GO:0090527	actin filament reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of actin filaments.
	GO:0051014	actin filament severing	The process in which an actin filament is broken down into smaller filaments.
	GO:0045010	actin nucleation	The initial step in the formation of an actin filament, in which actin monomers combine to form a new filament. Nucleation is slow relative to the subsequent addition of more monomers to extend the filament.
	GO:0008154	actin polymerization or depolymerization	Assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:1990000	amyloid fibril formation	The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins. An example of this is seen when human RIP1 and RIP3 kinases form a heterodimeric functional amyloid signaling complex (PMID:22817896).
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0051016	barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0071276	cellular response to cadmium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0060271	cilium assembly	The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0097284	hepatocyte apoptotic process	Any apoptotic process in a hepatocyte, the main structural component of the liver.
	GO:0046597	negative regulation of viral entry into host cell	Any process that stops, prevents, or reduces the frequency, rate or extent of the entry of viral entry into a host cell.
	GO:0014003	oligodendrocyte development	The process aimed at the progression of an oligodendrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An oligodendrocyte is a type of glial cell involved in myelinating the axons in the central nervous system.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0051127	positive regulation of actin nucleation	Any process that activates or increases the frequency, rate or extent of actin nucleation, the initial step in the formation of an actin filament in which actin monomers combine to form a new filament.
	GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1902174	positive regulation of keratinocyte apoptotic process	Any process that activates or increases the frequency, rate or extent of keratinocyte apoptotic process.
	GO:1903923	positive regulation of protein processing in phagocytic vesicle	Any process that activates or increases the frequency, rate or extent of protein processing in phagocytic vesicle.
	GO:0031648	protein destabilization	Any process that decreases the stability of a protein, making it more vulnerable to degradative processes or aggregation.
	GO:0030155	regulation of cell adhesion	Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
	GO:1903903	regulation of establishment of T cell polarity	Any process that modulates the frequency, rate or extent of establishment of T cell polarity.
	GO:1903906	regulation of plasma membrane raft polarization	Any process that modulates the frequency, rate or extent of plasma membrane raft polarization.
	GO:0071801	regulation of podosome assembly	Any process that modulates the frequency, rate or extent of podosome assembly.
	GO:1903909	regulation of receptor clustering	Any process that modulates the frequency, rate or extent of receptor clustering.
	GO:1903689	regulation of wound healing, spreading of epidermal cells	Any process that modulates the frequency, rate or extent of wound healing, spreading of epidermal cells.
	GO:0097017	renal protein absorption	A renal system process in which proteins are taken up from the collecting ducts, glomerulus and proximal and distal loops of the nephron. In non-mammalian species, absorption may occur in related structures (e.g. protein absorption is observed in nephrocytes in Drosophila, see PMID:23264686).
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0051593	response to folic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a folic acid stimulus.
	GO:0042989	sequestering of actin monomers	The selective interaction of actin monomers with specific molecules that inhibit their polymerization by preventing their access to other monomers.
	GO:0014891	striated muscle atrophy	A process, occurring in striated muscle, that is characterized by a decrease in protein content, fiber diameter, force production and fatigue resistance in response to different conditions such as starvation, aging and disuse.
	GO:0042246	tissue regeneration	The regrowth of lost or destroyed tissues.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0030478	actin cap	Polarized accumulation of cytoskeletal proteins (including F-actin) and regulatory proteins in a cell. An example of this is the actin cap found in Saccharomyces cerevisiae.
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0002102	podosome	An actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell, contain an F-actin-rich core surrounded by a ring structure containing proteins such as vinculin and talin, and have a diameter of 0.5 mm.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0016528	sarcoplasm	The cytoplasm of a muscle cell; includes the sarcoplasmic reticulum.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fh2)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2fh2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GELS_HUMAN \| P06396
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GELS_HUMAN \| P06396
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

2fh1	THE SAME PROTEIN SOAKED IN LOW CALCIUM AT PH 4.5
2fh3	THE SAME PROTEIN SOAKED IN LOW CALCIUM AT PH 8
2fh4	THE SAME PROTEIN SOAKED IN EGTA AT PH 8

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 6)

PROSITE Motifs (0, 0)

Exons (9, 27)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 9)

CATH Domains (1, 9)

Pfam Domains (0, 0)

Gene Ontology (66, 66)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File