1YAG - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF THE YEAST ACTIN-HUMAN GELSOLIN SEGMENT 1 COMPLEX

Authors :   S. Vorobiev, B. Strokopytov, C. Frieden, S. C. Almo

Date :   09 Oct 98 (Deposition) - 09 Oct 99 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,G
Biol. Unit 1: A,G  (1x)
Biol. Unit 2: A,G  (2x)

Keywords :   Complex, Actin, Gelsolin, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Vorobiev, B. Strokopytov, D. G. Drubin, C. Frieden, S. Ono, J. Condeelis, P. A. Rubenstein, S. C. Almo
The Structure Of Nonvertebrate Actin: Implications For The Atp Hydrolytic Mechanism
Proc. Natl. Acad. Sci. Usa V. 100 5760 2003
PubMed-ID: 12732734 | Reference-DOI: 10.1073/PNAS.0832273100
(for further references see the PDB file header)

Molecule 1 - PROTEIN (ACTIN)
	Chains	:	A
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Strain	:	RED STAR

Molecule 2 - PROTEIN (GELSOLIN)
	Chains	:	G
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	SUBDOMAIN 1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ACTIN-DEPOLYMERIZING FACTOR (ADF)

		1	2
Asymmetric Unit	:	A	G
Biological Unit 1 (1x)	:	A	G
Biological Unit 2 (2x)	:	A	G

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 4)

No.	Name	Count	Type	Full Name
1	ATP	1	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	1	Ligand/Ion	CALCIUM ION
3	MG	1	Ligand/Ion	MAGNESIUM ION
4	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	ATP	1	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	-1	Ligand/Ion	CALCIUM ION
3	MG	-1	Ligand/Ion	MAGNESIUM ION
4	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	-1	Ligand/Ion	CALCIUM ION
3	MG	-1	Ligand/Ion	MAGNESIUM ION
4	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ATP A:378 , HOH A:386 , HOH A:387 , HOH A:394 , HOH A:396	BINDING SITE FOR RESIDUE MG A 376
2	AC2	SOFTWARE	GLY G:41 , ASP G:42 , GLU G:73 , VAL G:121 , HOH G:151 , HOH G:158	BINDING SITE FOR RESIDUE CA G 126
3	AC3	SOFTWARE	ARG A:62 , THR A:202 , THR A:203 , ALA A:204	BINDING SITE FOR RESIDUE SO4 A 377
4	AC4	SOFTWARE	GLY A:13 , SER A:14 , GLY A:15 , MET A:16 , LYS A:18 , GLY A:156 , ASP A:157 , GLY A:158 , VAL A:159 , GLY A:182 , ARG A:210 , LYS A:213 , GLU A:214 , GLY A:301 , GLY A:302 , THR A:303 , MET A:305 , PHE A:306 , LYS A:336 , MG A:376 , HOH A:386 , HOH A:387 , HOH A:394 , HOH A:397 , HOH A:413 , HOH A:416 , HOH A:474 , HOH A:504 , HOH A:587	BINDING SITE FOR RESIDUE ATP A 378

(no "SS Bond" information available for 1YAG)

(no "Cis Peptide Bond" information available for 1YAG)

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024690	A	129	T	GELS_HUMAN	Polymorphism	2230287	G	A	78	T
2	UniProt	VAR_ACT_YEAST_001 *	Y	143	F	ACT_YEAST	---	---	A	Y	143	F
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024690	A	129	T	GELS_HUMAN	Polymorphism	2230287	G	A	78	T
2	UniProt	VAR_ACT_YEAST_001 *	Y	143	F	ACT_YEAST	---	---	A	Y	143	F
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024690	A	129	T	GELS_HUMAN	Polymorphism	2230287	G	A	78	T
2	UniProt	VAR_ACT_YEAST_001 *	Y	143	F	ACT_YEAST	---	---	A	Y	143	F
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACTINS_1	PS00406	Actins signature 1.	ACT_YEAST	53-63	1	A:53-63
2	ACTINS_ACT_LIKE	PS01132	Actins and actin-related proteins signature.	ACT_YEAST	104-116	1	A:104-116
3	ACTINS_2	PS00432	Actins signature 2.	ACT_YEAST	356-364	1	A:356-364

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACTINS_1	PS00406	Actins signature 1.	ACT_YEAST	53-63	1	A:53-63
2	ACTINS_ACT_LIKE	PS01132	Actins and actin-related proteins signature.	ACT_YEAST	104-116	1	A:104-116
3	ACTINS_2	PS00432	Actins signature 2.	ACT_YEAST	356-364	1	A:356-364

Biological Unit 2 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACTINS_1	PS00406	Actins signature 1.	ACT_YEAST	53-63	2	A:53-63
2	ACTINS_ACT_LIKE	PS01132	Actins and actin-related proteins signature.	ACT_YEAST	104-116	2	A:104-116
3	ACTINS_2	PS00432	Actins signature 2.	ACT_YEAST	356-364	2	A:356-364

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.14	ENST00000373818	14	ENSE00001461665	chr9:124062071-124062283	213	GELS_HUMAN	1-48	48	0	-	-
1.16d	ENST00000373818	16d	ENSE00001725493	chr9:124064241-124064445	205	GELS_HUMAN	49-117	69	1	G:1-66	66
1.17	ENST00000373818	17	ENSE00001745162	chr9:124065189-124065343	155	GELS_HUMAN	117-168	52	1	G:66-117	52
1.18b	ENST00000373818	18b	ENSE00001764209	chr9:124072962-124073123	162	GELS_HUMAN	169-222	54	1	G:118-125	8
1.18f	ENST00000373818	18f	ENSE00001689299	chr9:124074617-124074766	150	GELS_HUMAN	223-272	50	0	-	-
1.18i	ENST00000373818	18i	ENSE00001727906	chr9:124076212-124076301	90	GELS_HUMAN	273-302	30	0	-	-
1.19b	ENST00000373818	19b	ENSE00001732099	chr9:124079364-124079496	133	GELS_HUMAN	303-347	45	0	-	-
1.20	ENST00000373818	20	ENSE00001734404	chr9:124080684-124080772	89	GELS_HUMAN	347-376	30	0	-	-
1.21a	ENST00000373818	21a	ENSE00001618926	chr9:124080943-124081158	216	GELS_HUMAN	377-448	72	0	-	-
1.22b	ENST00000373818	22b	ENSE00001591416	chr9:124083546-124083679	134	GELS_HUMAN	449-493	45	0	-	-
1.23	ENST00000373818	23	ENSE00001735249	chr9:124086832-124086922	91	GELS_HUMAN	493-523	31	0	-	-
1.24a	ENST00000373818	24a	ENSE00001704432	chr9:124088790-124088960	171	GELS_HUMAN	524-580	57	0	-	-
1.25	ENST00000373818	25	ENSE00001668309	chr9:124089586-124089760	175	GELS_HUMAN	581-639	59	0	-	-
1.26b	ENST00000373818	26b	ENSE00001721539	chr9:124091169-124091293	125	GELS_HUMAN	639-680	42	0	-	-
1.26c	ENST00000373818	26c	ENSE00001771020	chr9:124091516-124091593	78	GELS_HUMAN	681-706	26	0	-	-
1.27a	ENST00000373818	27a	ENSE00001779366	chr9:124093666-124093726	61	GELS_HUMAN	707-727	21	0	-	-
1.28d	ENST00000373818	28d	ENSE00001732346	chr9:124094712-124095120	409	GELS_HUMAN	727-782	56	0	-	-

2.1	YFL039C	1	YFL039C.1	VI:54695-54686	10	ACT_YEAST	1-4	4	1	A:4-4	1
2.2	YFL039C	2	YFL039C.2	VI:54377-53260	1118	ACT_YEAST	4-375	372	1	A:4-375	372

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:372
 aligned with ACT_YEAST | P60010 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:372
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  
            ACT_YEAST     4 EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375
               SCOP domains d1yaga1 A:4-146 Actin                                                                                                                          d1yaga2 A:147-375 Actin                                                                                                                                                                                                               SCOP domains
               CATH domains 1yagA01                        1yagA02 A:35-68                   --1yagA01 A:4-34,A:71-134,A:337-373                               -1yagA03 A:136-181,A:271-332                   1yagA04 A:182-267 Actin; Chain A, domain 4                                            ---1yagA03 A:136-181,A:271-332                                   ----1yagA01 A:4-34,A:71-134,A:337-373    -- CATH domains
               Pfam domains Actin-1yagA01 A:4-375                                                                                                                                                                                                                                                                                                                                                                Pfam domains
         Sec.struct. author ....eeeee...eeeeee.......eeee..eeee.................hhhhh.hhheeee..........hhhhhhhhhhhhh......hhh..eeeee.....hhhhhhhhhhhhh......eeeeehhhhhhhh.....eeeeee....eeeeee......hhh.eee...hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh......hhhhhhhhh......eeee.....eeee.hhhhh.hhhhh.hhhh......hhhhhhhhhhh..hhhhhhhh..eeee.hhh....hhhhhhhhhhhh.................hhhhhhhhhhh.hhhhh....hhhhhhh.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------F---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------ACTINS_1   ----------------------------------------ACTINS_ACT_LI-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACTINS_2 ----------- PROSITE
           Transcript 2 (1) 2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) Exon 2.2  PDB: A:4-375 UniProt: 4-375                                                                                                                                                                                                                                                                                                                                                Transcript 2 (2)
                 1yag A   4 EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373

Chain G from PDB  Type:PROTEIN  Length:125
 aligned with GELS_HUMAN | P06396 from UniProtKB/Swiss-Prot  Length:782

    Alignment length:125
                                    61        71        81        91       101       111       121       131       141       151       161       171     
           GELS_HUMAN    52 MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF 176
               SCOP domains d1yagg_ G: Gelsolin                                                                                                           SCOP domains
               CATH domains 1yagG00 G:1-125 Severin                                                                                                       CATH domains
               Pfam domains -----------------------Gelsolin-1yagG01 G:24-107                                                           ------------------ Pfam domains
         Sec.struct. author .....hhhhh.....eeeeeeee..eeee..hhh..eee...eeeeeeeee.....eeeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeee.....hhhhhh.....eee........ Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------T----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16d  PDB: G:1-66 UniProt: 49-117 [INCOMPLETE]              ---------------------------------------------------1.18b    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------Exon 1.17  PDB: G:66-117 UniProt: 117-168           -------- Transcript 1 (2)
                 1yag G   1 MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF 125
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Gelsolin-like (96)

Superfamily: Actin depolymerizing proteins (88)

Family: Gelsolin-like (43)

Protein domain: Gelsolin (33)

Human (Homo sapiens) [TaxId: 9606] (31)

d1yagg_

Class: Alpha and beta proteins (a/b) (23833)

Fold: Ribonuclease H-like motif (1424)

Superfamily: Actin-like ATPase domain (426)

Family: Actin/HSP70 (199)

Protein domain: Actin (69)

Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932] (2)

2a	d1yaga1	A:4-146
2b	d1yaga2	A:147-375

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: ADF (44)

Family: Gelsolin (23)

Homo sapiens (Human) (13)

Gelsolin-1yagG01

G:24-107

Clan: Actin_ATPase (173)

Family: Actin (70)

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) (3)

Actin-1yagA01

A:4-375

Asymmetric Unit(hide GO term definitions)

Chain A (ACT_YEAST | P60010)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004402	histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0000916	actomyosin contractile ring contraction	The process of an actomyosin ring getting smaller in diameter, in the context of cytokinesis that takes place as part of a cell cycle.
	GO:0030476	ascospore wall assembly	The aggregation, arrangement and bonding together of a set of components to form an ascospore wall. During sporulation in Ascomycota, each ascospore nucleus becomes surrounded by a specialized spore wall, formed by deposition of spore wall components in the lumenal space between the outer and inner leaflets of the prospore membrane. An example of this process is found in Saccharomyces cerevisiae.
	GO:0007119	budding cell isotropic bud growth	Unlocalized bud growth such that the entire surface of the bud expands evenly, in a cell that reproduces by budding.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0001300	chronological cell aging	The process associated with progression of the cell from its inception to the end of its lifespan that occurs when the cell is in a non-dividing, or quiescent, state.
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0030010	establishment of cell polarity	The specification and formation of anisotropic intracellular organization or cell growth patterns.
	GO:0000132	establishment of mitotic spindle orientation	A cell cycle process that sets the alignment of mitotic spindle relative to other cellular structures.
	GO:0006887	exocytosis	A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
	GO:0031505	fungal-type cell wall organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the fungal-type cell wall.
	GO:0016573	histone acetylation	The modification of a histone by the addition of an acetyl group.
	GO:0000001	mitochondrion inheritance	The distribution of mitochondria, including the mitochondrial genome, into daughter cells after mitosis or meiosis, mediated by interactions between mitochondria and the cytoskeleton.
	GO:0009306	protein secretion	The controlled release of proteins from a cell.
	GO:0000011	vacuole inheritance	The distribution of vacuoles into daughter cells after mitosis or meiosis, mediated by interactions between vacuoles and the cytoskeleton.
	GO:0030050	vesicle transport along actin filament	Movement of a vesicle along an actin filament, mediated by motor proteins.
cellular component
	GO:0031011	Ino80 complex	A multisubunit protein complex that contains the Ino80p ATPase; exhibits chromatin remodeling activity and 3' to 5' DNA helicase activity.
	GO:0035267	NuA4 histone acetyltransferase complex	A complex having histone acetylase activity on chromatin, as well as ATPase, DNA helicase and structural DNA binding activities. The complex is thought to be involved in double-strand DNA break repair. Subunits of the human complex include HTATIP/TIP60, TRRAP, RUVBL1, BUVBL2, beta-actin and BAF53/ACTL6A. In yeast, the complex has 13 subunits, including the catalytic subunit Esa1 (homologous to human Tip60).
	GO:0000812	Swr1 complex	A multisubunit protein complex that is involved in chromatin remodeling. It is required for the incorporation of the histone variant H2AZ into chromatin. In S. cerevisiae, the complex contains Swr1p, a Swi2/Snf2-related ATPase, and 12 additional subunits.
	GO:0030479	actin cortical patch	An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0032432	actin filament bundle	An assembly of actin filaments that are on the same axis but may be oriented with the same or opposite polarities and may be packed with different levels of tightness.
	GO:0000142	cellular bud neck contractile ring	A contractile ring, i.e. a cytoskeletal structure composed of actin filaments and myosin, that forms beneath the plasma membrane at the mother-bud neck in mitotic cells that divide by budding in preparation for completing cytokinesis. An example of this structure is found in Saccharomyces cerevisiae.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Chain G (GELS_HUMAN | P06396)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0045159	myosin II binding	Interacting selectively and non-covalently with a class II myosin, any member of the class of 'conventional' double-headed myosins that includes muscle myosin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030041	actin filament polymerization	Assembly of actin filaments by the addition of actin monomers to a filament.
	GO:0090527	actin filament reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of actin filaments.
	GO:0051014	actin filament severing	The process in which an actin filament is broken down into smaller filaments.
	GO:0045010	actin nucleation	The initial step in the formation of an actin filament, in which actin monomers combine to form a new filament. Nucleation is slow relative to the subsequent addition of more monomers to extend the filament.
	GO:0008154	actin polymerization or depolymerization	Assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:1990000	amyloid fibril formation	The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins. An example of this is seen when human RIP1 and RIP3 kinases form a heterodimeric functional amyloid signaling complex (PMID:22817896).
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0051016	barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0071276	cellular response to cadmium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0060271	cilium assembly	The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0097284	hepatocyte apoptotic process	Any apoptotic process in a hepatocyte, the main structural component of the liver.
	GO:0046597	negative regulation of viral entry into host cell	Any process that stops, prevents, or reduces the frequency, rate or extent of the entry of viral entry into a host cell.
	GO:0014003	oligodendrocyte development	The process aimed at the progression of an oligodendrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An oligodendrocyte is a type of glial cell involved in myelinating the axons in the central nervous system.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0051127	positive regulation of actin nucleation	Any process that activates or increases the frequency, rate or extent of actin nucleation, the initial step in the formation of an actin filament in which actin monomers combine to form a new filament.
	GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1902174	positive regulation of keratinocyte apoptotic process	Any process that activates or increases the frequency, rate or extent of keratinocyte apoptotic process.
	GO:1903923	positive regulation of protein processing in phagocytic vesicle	Any process that activates or increases the frequency, rate or extent of protein processing in phagocytic vesicle.
	GO:0031648	protein destabilization	Any process that decreases the stability of a protein, making it more vulnerable to degradative processes or aggregation.
	GO:0030155	regulation of cell adhesion	Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
	GO:1903903	regulation of establishment of T cell polarity	Any process that modulates the frequency, rate or extent of establishment of T cell polarity.
	GO:1903906	regulation of plasma membrane raft polarization	Any process that modulates the frequency, rate or extent of plasma membrane raft polarization.
	GO:0071801	regulation of podosome assembly	Any process that modulates the frequency, rate or extent of podosome assembly.
	GO:1903909	regulation of receptor clustering	Any process that modulates the frequency, rate or extent of receptor clustering.
	GO:1903689	regulation of wound healing, spreading of epidermal cells	Any process that modulates the frequency, rate or extent of wound healing, spreading of epidermal cells.
	GO:0097017	renal protein absorption	A renal system process in which proteins are taken up from the collecting ducts, glomerulus and proximal and distal loops of the nephron. In non-mammalian species, absorption may occur in related structures (e.g. protein absorption is observed in nephrocytes in Drosophila, see PMID:23264686).
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0051593	response to folic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a folic acid stimulus.
	GO:0042989	sequestering of actin monomers	The selective interaction of actin monomers with specific molecules that inhibit their polymerization by preventing their access to other monomers.
	GO:0014891	striated muscle atrophy	A process, occurring in striated muscle, that is characterized by a decrease in protein content, fiber diameter, force production and fatigue resistance in response to different conditions such as starvation, aging and disuse.
	GO:0042246	tissue regeneration	The regrowth of lost or destroyed tissues.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0030478	actin cap	Polarized accumulation of cytoskeletal proteins (including F-actin) and regulatory proteins in a cell. An example of this is the actin cap found in Saccharomyces cerevisiae.
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0002102	podosome	An actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell, contain an F-actin-rich core surrounded by a ring structure containing proteins such as vinculin and talin, and have a diameter of 0.5 mm.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0016528	sarcoplasm	The cytoplasm of a muscle cell; includes the sarcoplasmic reticulum.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ATP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yag)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1yag
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACT_YEAST \| P60010
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GELS_HUMAN \| P06396
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACT_YEAST \| P60010
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GELS_HUMAN \| P06396
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1YAG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (3, 3)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (4, 5)

Pfam Domains (2, 2)

Gene Ontology (93, 96)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File