3EZ5 - JenaLib

Asymmetric Unit (48, 96)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_DPO1_GEOSE_001 *	G	298	K	DPO1_GEOSE	---	---	A/D	K	298	K
02	UniProt	VAR_DPO1_GEOSE_002 *	D	300	A	DPO1_GEOSE	---	---	A/D	A	300	A
03	UniProt	VAR_DPO1_GEOSE_003 *	S	306	R	DPO1_GEOSE	---	---	A/D	R	306	R
04	UniProt	VAR_DPO1_GEOSE_004 *	D	309	E	DPO1_GEOSE	---	---	A/D	E	309	E
05	UniProt	VAR_DPO1_GEOSE_005 *	V	320	L	DPO1_GEOSE	---	---	A/D	V	320	L
06	UniProt	VAR_DPO1_GEOSE_006 *	H	329	D	DPO1_GEOSE	---	---	A/D	D	329	D
07	UniProt	VAR_DPO1_GEOSE_007 *	R	341	H	DPO1_GEOSE	---	---	A/D	H	341	H
08	UniProt	VAR_DPO1_GEOSE_008 *	K	356	Q	DPO1_GEOSE	---	---	A/D	Q	356	Q
09	UniProt	VAR_DPO1_GEOSE_009 *	L	358	V	DPO1_GEOSE	---	---	A/D	V	358	V
10	UniProt	VAR_DPO1_GEOSE_010 *	T	369	S	DPO1_GEOSE	---	---	A/D	S	369	S
11	UniProt	VAR_DPO1_GEOSE_011 *	R	388	C	DPO1_GEOSE	---	---	A/D	C	388	C
12	UniProt	VAR_DPO1_GEOSE_012 *	V	391	S	DPO1_GEOSE	---	---	A/D	S	391	S
13	UniProt	VAR_DPO1_GEOSE_013 *	A	411	R	DPO1_GEOSE	---	---	A/D	A	411	R
14	UniProt	VAR_DPO1_GEOSE_014 *	V	413	A	DPO1_GEOSE	---	---	A/D	A	413	A
15	UniProt	VAR_DPO1_GEOSE_015 *	H	417	K	DPO1_GEOSE	---	---	A/D	K	417	K
16	UniProt	VAR_DPO1_GEOSE_016 *	S	424	P	DPO1_GEOSE	---	---	A/D	P	424	P
17	UniProt	VAR_DPO1_GEOSE_017 *	T	436	A	DPO1_GEOSE	---	---	A/D	A	436	A
18	UniProt	VAR_DPO1_GEOSE_018 *	T	442	V	DPO1_GEOSE	---	---	A/D	V	442	V
19	UniProt	VAR_DPO1_GEOSE_019 *	A	456	E	DPO1_GEOSE	---	---	A/D	E	456	E
20	UniProt	VAR_DPO1_GEOSE_020 *	E	459	R	DPO1_GEOSE	---	---	A/D	R	459	R
21	UniProt	VAR_DPO1_GEOSE_021 *	T	475	V	DPO1_GEOSE	---	---	A/D	V	475	V
22	UniProt	VAR_DPO1_GEOSE_022 *	N	487	E	DPO1_GEOSE	---	---	A/D	E	487	E
23	UniProt	VAR_DPO1_GEOSE_023 *	T	491	A	DPO1_GEOSE	---	---	A/D	A	491	A
24	UniProt	VAR_DPO1_GEOSE_024 *	A	505	K	DPO1_GEOSE	---	---	A/D	K	505	K
25	UniProt	VAR_DPO1_GEOSE_025 *	T	508	R	DPO1_GEOSE	---	---	A/D	A	508	R
26	UniProt	VAR_DPO1_GEOSE_026 *	Q	510	K	DPO1_GEOSE	---	---	A/D	Q	510	K
27	UniProt	VAR_DPO1_GEOSE_027 *	R	516	Q	DPO1_GEOSE	---	---	A/D	Q	516	Q
28	UniProt	VAR_DPO1_GEOSE_028 *	D	540	E	DPO1_GEOSE	---	---	A/D	E	540	E
29	UniProt	VAR_DPO1_GEOSE_029 *	H	567	Y	DPO1_GEOSE	---	---	A/D	Y	567	Y
30	UniProt	VAR_DPO1_GEOSE_030 *	H	573	N	DPO1_GEOSE	---	---	A/D	N	573	N
31	UniProt	VAR_DPO1_GEOSE_031 *	H	596	R	DPO1_GEOSE	---	---	A/D	R	596	R
32	UniProt	VAR_DPO1_GEOSE_032 *	V	598	D	DPO1_GEOSE	---	---	A/D	A	598	D
33	UniProt	VAR_DPO1_GEOSE_033 *	G	600	K	DPO1_GEOSE	---	---	A/D	K	600	K
34	UniProt	VAR_DPO1_GEOSE_034 *	M	605	I	DPO1_GEOSE	---	---	A/D	I	605	I
35	UniProt	VAR_DPO1_GEOSE_035 *	V	619	T	DPO1_GEOSE	---	---	A/D	T	619	T
36	UniProt	VAR_DPO1_GEOSE_036 *	P	645	S	DPO1_GEOSE	---	---	A/D	S	645	S
37	UniProt	VAR_DPO1_GEOSE_037 *	I	672	M	DPO1_GEOSE	---	---	A/D	M	672	M
38	UniProt	VAR_DPO1_GEOSE_038 *	G	678	D	DPO1_GEOSE	---	---	A/D	D	678	D
39	UniProt	VAR_DPO1_GEOSE_039 *	H	691	Q	DPO1_GEOSE	---	---	A/D	Q	691	Q
40	UniProt	VAR_DPO1_GEOSE_040 *	A	699	P	DPO1_GEOSE	---	---	A/D	P	699	P
41	UniProt	VAR_DPO1_GEOSE_041 *	T	728	S	DPO1_GEOSE	---	---	A/D	S	728	S
42	UniProt	VAR_DPO1_GEOSE_042 *	A	741	E	DPO1_GEOSE	---	---	A/D	E	741	E
43	UniProt	VAR_DPO1_GEOSE_043 *	Q	748	R	DPO1_GEOSE	---	---	A/D	R	748	R
44	UniProt	VAR_DPO1_GEOSE_044 *	D	751	E	DPO1_GEOSE	---	---	A/D	E	751	E
45	UniProt	VAR_DPO1_GEOSE_045 *	T	790	M	DPO1_GEOSE	---	---	A/D	M	790	M
46	UniProt	VAR_DPO1_GEOSE_046 *	R	816	K	DPO1_GEOSE	---	---	A/D	K	816	K
47	UniProt	VAR_DPO1_GEOSE_047 *	I	841	M	DPO1_GEOSE	---	---	A/D	M	841	M
48	UniProt	VAR_DPO1_GEOSE_048 *	P	870	S	DPO1_GEOSE	---	---	A/D	S	870	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (48, 48)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_DPO1_GEOSE_001 *	G	298	K	DPO1_GEOSE	---	---	A	K	298	K
02	UniProt	VAR_DPO1_GEOSE_002 *	D	300	A	DPO1_GEOSE	---	---	A	A	300	A
03	UniProt	VAR_DPO1_GEOSE_003 *	S	306	R	DPO1_GEOSE	---	---	A	R	306	R
04	UniProt	VAR_DPO1_GEOSE_004 *	D	309	E	DPO1_GEOSE	---	---	A	E	309	E
05	UniProt	VAR_DPO1_GEOSE_005 *	V	320	L	DPO1_GEOSE	---	---	A	V	320	L
06	UniProt	VAR_DPO1_GEOSE_006 *	H	329	D	DPO1_GEOSE	---	---	A	D	329	D
07	UniProt	VAR_DPO1_GEOSE_007 *	R	341	H	DPO1_GEOSE	---	---	A	H	341	H
08	UniProt	VAR_DPO1_GEOSE_008 *	K	356	Q	DPO1_GEOSE	---	---	A	Q	356	Q
09	UniProt	VAR_DPO1_GEOSE_009 *	L	358	V	DPO1_GEOSE	---	---	A	V	358	V
10	UniProt	VAR_DPO1_GEOSE_010 *	T	369	S	DPO1_GEOSE	---	---	A	S	369	S
11	UniProt	VAR_DPO1_GEOSE_011 *	R	388	C	DPO1_GEOSE	---	---	A	C	388	C
12	UniProt	VAR_DPO1_GEOSE_012 *	V	391	S	DPO1_GEOSE	---	---	A	S	391	S
13	UniProt	VAR_DPO1_GEOSE_013 *	A	411	R	DPO1_GEOSE	---	---	A	A	411	R
14	UniProt	VAR_DPO1_GEOSE_014 *	V	413	A	DPO1_GEOSE	---	---	A	A	413	A
15	UniProt	VAR_DPO1_GEOSE_015 *	H	417	K	DPO1_GEOSE	---	---	A	K	417	K
16	UniProt	VAR_DPO1_GEOSE_016 *	S	424	P	DPO1_GEOSE	---	---	A	P	424	P
17	UniProt	VAR_DPO1_GEOSE_017 *	T	436	A	DPO1_GEOSE	---	---	A	A	436	A
18	UniProt	VAR_DPO1_GEOSE_018 *	T	442	V	DPO1_GEOSE	---	---	A	V	442	V
19	UniProt	VAR_DPO1_GEOSE_019 *	A	456	E	DPO1_GEOSE	---	---	A	E	456	E
20	UniProt	VAR_DPO1_GEOSE_020 *	E	459	R	DPO1_GEOSE	---	---	A	R	459	R
21	UniProt	VAR_DPO1_GEOSE_021 *	T	475	V	DPO1_GEOSE	---	---	A	V	475	V
22	UniProt	VAR_DPO1_GEOSE_022 *	N	487	E	DPO1_GEOSE	---	---	A	E	487	E
23	UniProt	VAR_DPO1_GEOSE_023 *	T	491	A	DPO1_GEOSE	---	---	A	A	491	A
24	UniProt	VAR_DPO1_GEOSE_024 *	A	505	K	DPO1_GEOSE	---	---	A	K	505	K
25	UniProt	VAR_DPO1_GEOSE_025 *	T	508	R	DPO1_GEOSE	---	---	A	A	508	R
26	UniProt	VAR_DPO1_GEOSE_026 *	Q	510	K	DPO1_GEOSE	---	---	A	Q	510	K
27	UniProt	VAR_DPO1_GEOSE_027 *	R	516	Q	DPO1_GEOSE	---	---	A	Q	516	Q
28	UniProt	VAR_DPO1_GEOSE_028 *	D	540	E	DPO1_GEOSE	---	---	A	E	540	E
29	UniProt	VAR_DPO1_GEOSE_029 *	H	567	Y	DPO1_GEOSE	---	---	A	Y	567	Y
30	UniProt	VAR_DPO1_GEOSE_030 *	H	573	N	DPO1_GEOSE	---	---	A	N	573	N
31	UniProt	VAR_DPO1_GEOSE_031 *	H	596	R	DPO1_GEOSE	---	---	A	R	596	R
32	UniProt	VAR_DPO1_GEOSE_032 *	V	598	D	DPO1_GEOSE	---	---	A	A	598	D
33	UniProt	VAR_DPO1_GEOSE_033 *	G	600	K	DPO1_GEOSE	---	---	A	K	600	K
34	UniProt	VAR_DPO1_GEOSE_034 *	M	605	I	DPO1_GEOSE	---	---	A	I	605	I
35	UniProt	VAR_DPO1_GEOSE_035 *	V	619	T	DPO1_GEOSE	---	---	A	T	619	T
36	UniProt	VAR_DPO1_GEOSE_036 *	P	645	S	DPO1_GEOSE	---	---	A	S	645	S
37	UniProt	VAR_DPO1_GEOSE_037 *	I	672	M	DPO1_GEOSE	---	---	A	M	672	M
38	UniProt	VAR_DPO1_GEOSE_038 *	G	678	D	DPO1_GEOSE	---	---	A	D	678	D
39	UniProt	VAR_DPO1_GEOSE_039 *	H	691	Q	DPO1_GEOSE	---	---	A	Q	691	Q
40	UniProt	VAR_DPO1_GEOSE_040 *	A	699	P	DPO1_GEOSE	---	---	A	P	699	P
41	UniProt	VAR_DPO1_GEOSE_041 *	T	728	S	DPO1_GEOSE	---	---	A	S	728	S
42	UniProt	VAR_DPO1_GEOSE_042 *	A	741	E	DPO1_GEOSE	---	---	A	E	741	E
43	UniProt	VAR_DPO1_GEOSE_043 *	Q	748	R	DPO1_GEOSE	---	---	A	R	748	R
44	UniProt	VAR_DPO1_GEOSE_044 *	D	751	E	DPO1_GEOSE	---	---	A	E	751	E
45	UniProt	VAR_DPO1_GEOSE_045 *	T	790	M	DPO1_GEOSE	---	---	A	M	790	M
46	UniProt	VAR_DPO1_GEOSE_046 *	R	816	K	DPO1_GEOSE	---	---	A	K	816	K
47	UniProt	VAR_DPO1_GEOSE_047 *	I	841	M	DPO1_GEOSE	---	---	A	M	841	M
48	UniProt	VAR_DPO1_GEOSE_048 *	P	870	S	DPO1_GEOSE	---	---	A	S	870	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (48, 48)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_DPO1_GEOSE_001 *	G	298	K	DPO1_GEOSE	---	---	D	K	298	K
02	UniProt	VAR_DPO1_GEOSE_002 *	D	300	A	DPO1_GEOSE	---	---	D	A	300	A
03	UniProt	VAR_DPO1_GEOSE_003 *	S	306	R	DPO1_GEOSE	---	---	D	R	306	R
04	UniProt	VAR_DPO1_GEOSE_004 *	D	309	E	DPO1_GEOSE	---	---	D	E	309	E
05	UniProt	VAR_DPO1_GEOSE_005 *	V	320	L	DPO1_GEOSE	---	---	D	V	320	L
06	UniProt	VAR_DPO1_GEOSE_006 *	H	329	D	DPO1_GEOSE	---	---	D	D	329	D
07	UniProt	VAR_DPO1_GEOSE_007 *	R	341	H	DPO1_GEOSE	---	---	D	H	341	H
08	UniProt	VAR_DPO1_GEOSE_008 *	K	356	Q	DPO1_GEOSE	---	---	D	Q	356	Q
09	UniProt	VAR_DPO1_GEOSE_009 *	L	358	V	DPO1_GEOSE	---	---	D	V	358	V
10	UniProt	VAR_DPO1_GEOSE_010 *	T	369	S	DPO1_GEOSE	---	---	D	S	369	S
11	UniProt	VAR_DPO1_GEOSE_011 *	R	388	C	DPO1_GEOSE	---	---	D	C	388	C
12	UniProt	VAR_DPO1_GEOSE_012 *	V	391	S	DPO1_GEOSE	---	---	D	S	391	S
13	UniProt	VAR_DPO1_GEOSE_013 *	A	411	R	DPO1_GEOSE	---	---	D	A	411	R
14	UniProt	VAR_DPO1_GEOSE_014 *	V	413	A	DPO1_GEOSE	---	---	D	A	413	A
15	UniProt	VAR_DPO1_GEOSE_015 *	H	417	K	DPO1_GEOSE	---	---	D	K	417	K
16	UniProt	VAR_DPO1_GEOSE_016 *	S	424	P	DPO1_GEOSE	---	---	D	P	424	P
17	UniProt	VAR_DPO1_GEOSE_017 *	T	436	A	DPO1_GEOSE	---	---	D	A	436	A
18	UniProt	VAR_DPO1_GEOSE_018 *	T	442	V	DPO1_GEOSE	---	---	D	V	442	V
19	UniProt	VAR_DPO1_GEOSE_019 *	A	456	E	DPO1_GEOSE	---	---	D	E	456	E
20	UniProt	VAR_DPO1_GEOSE_020 *	E	459	R	DPO1_GEOSE	---	---	D	R	459	R
21	UniProt	VAR_DPO1_GEOSE_021 *	T	475	V	DPO1_GEOSE	---	---	D	V	475	V
22	UniProt	VAR_DPO1_GEOSE_022 *	N	487	E	DPO1_GEOSE	---	---	D	E	487	E
23	UniProt	VAR_DPO1_GEOSE_023 *	T	491	A	DPO1_GEOSE	---	---	D	A	491	A
24	UniProt	VAR_DPO1_GEOSE_024 *	A	505	K	DPO1_GEOSE	---	---	D	K	505	K
25	UniProt	VAR_DPO1_GEOSE_025 *	T	508	R	DPO1_GEOSE	---	---	D	A	508	R
26	UniProt	VAR_DPO1_GEOSE_026 *	Q	510	K	DPO1_GEOSE	---	---	D	Q	510	K
27	UniProt	VAR_DPO1_GEOSE_027 *	R	516	Q	DPO1_GEOSE	---	---	D	Q	516	Q
28	UniProt	VAR_DPO1_GEOSE_028 *	D	540	E	DPO1_GEOSE	---	---	D	E	540	E
29	UniProt	VAR_DPO1_GEOSE_029 *	H	567	Y	DPO1_GEOSE	---	---	D	Y	567	Y
30	UniProt	VAR_DPO1_GEOSE_030 *	H	573	N	DPO1_GEOSE	---	---	D	N	573	N
31	UniProt	VAR_DPO1_GEOSE_031 *	H	596	R	DPO1_GEOSE	---	---	D	R	596	R
32	UniProt	VAR_DPO1_GEOSE_032 *	V	598	D	DPO1_GEOSE	---	---	D	A	598	D
33	UniProt	VAR_DPO1_GEOSE_033 *	G	600	K	DPO1_GEOSE	---	---	D	K	600	K
34	UniProt	VAR_DPO1_GEOSE_034 *	M	605	I	DPO1_GEOSE	---	---	D	I	605	I
35	UniProt	VAR_DPO1_GEOSE_035 *	V	619	T	DPO1_GEOSE	---	---	D	T	619	T
36	UniProt	VAR_DPO1_GEOSE_036 *	P	645	S	DPO1_GEOSE	---	---	D	S	645	S
37	UniProt	VAR_DPO1_GEOSE_037 *	I	672	M	DPO1_GEOSE	---	---	D	M	672	M
38	UniProt	VAR_DPO1_GEOSE_038 *	G	678	D	DPO1_GEOSE	---	---	D	D	678	D
39	UniProt	VAR_DPO1_GEOSE_039 *	H	691	Q	DPO1_GEOSE	---	---	D	Q	691	Q
40	UniProt	VAR_DPO1_GEOSE_040 *	A	699	P	DPO1_GEOSE	---	---	D	P	699	P
41	UniProt	VAR_DPO1_GEOSE_041 *	T	728	S	DPO1_GEOSE	---	---	D	S	728	S
42	UniProt	VAR_DPO1_GEOSE_042 *	A	741	E	DPO1_GEOSE	---	---	D	E	741	E
43	UniProt	VAR_DPO1_GEOSE_043 *	Q	748	R	DPO1_GEOSE	---	---	D	R	748	R
44	UniProt	VAR_DPO1_GEOSE_044 *	D	751	E	DPO1_GEOSE	---	---	D	E	751	E
45	UniProt	VAR_DPO1_GEOSE_045 *	T	790	M	DPO1_GEOSE	---	---	D	M	790	M
46	UniProt	VAR_DPO1_GEOSE_046 *	R	816	K	DPO1_GEOSE	---	---	D	K	816	K
47	UniProt	VAR_DPO1_GEOSE_047 *	I	841	M	DPO1_GEOSE	---	---	D	M	841	M
48	UniProt	VAR_DPO1_GEOSE_048 *	P	870	S	DPO1_GEOSE	---	---	D	S	870	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:580
 aligned with DPO1_GEOSE | P52026 from UniProtKB/Swiss-Prot  Length:876

    Alignment length:580
                                   306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876
           DPO1_GEOSE   297 AGMDFAIADSVTDEMLADKAALVVEVVGDNYHHAPIVGIALANERGRFFLRPETALADPKFLAWLGDETKKKTMFDSKRAAVALKWKGIELRGVVFDLLLAAYLLDPAQAAGDVAAVAKMHQYEAVRSDEAVYGKGAKRTVPDEPTLAEHLVRKAAAIWALEEPLMDELRRNEQDRLLTELEQPLAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTGYSTSADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPIQGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEEIERLCRLVPEVMEQAVTLRVPLKVDYHYGPTWYDAK 876
               SCOP domains d3ez5a1 A:297-468 Exonuclease domain of prokaryotic DNA polymerase                                                                                                          d3ez5a2 A:469-876 DNA polymerase I (Klenow fragment)                                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 3ez5A01 A:297-490  [code=3.30.420.10, no name defined]                                                                                                                                            3ez5A02 A:491-605 Taq DNA Polymerase; Chain T, domain 4                                                            3ez5A03 A:606-656,A:801-875                        3ez5A04 A:657-800 5' to 3' exonuclease, C-terminal subdomain                                                                                    3ez5A03 A:606-656,A:801-875  [code=3.30.70.370, no name defined]           - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee....hhhhh..eeeeeee............eeeeee..eeeeehhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhh.......eeeehhhhhhhhhhhhh..hhhhhhhh.......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh........ee..ee..hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee..eee.........eee..........hhhhhhhhh.ee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheee.....eee.hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee...eeeeeee..hhhhhhhhhhhhhhh.........eeeeee....... Sec.struct. author
                 SAPs(SNPs) -K-A-----R--E----------L--------D-----------H--------------Q-V----------S------------------C--S-------------------R-A---K------P-----------A-----V-------------E--R---------------V-----------E---A-------------K--R-K-----Q-----------------------E--------------------------Y-----N----------------------R-D-K----I-------------T-------------------------S--------------------------M-----D------------Q-------P----------------------------S------------E------R--E--------------------------------------M-------------------------K------------------------M----------------------------S------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DNA_POLYMERASE_A    ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ez5 A 297 KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK 876
                                   306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876

Chain B from PDB  Type:DNA  Length:9
                                         
                 3ez5 B  21 CCTGACTCG  29

Chain C from PDB  Type:DNA  Length:12
                                            
                 3ez5 C   1 ATTCGAGTCAGG  12
                                    10

Chain D from PDB  Type:PROTEIN  Length:579
 aligned with DPO1_GEOSE | P52026 from UniProtKB/Swiss-Prot  Length:876

    Alignment length:579
                                   307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867         
           DPO1_GEOSE   298 GMDFAIADSVTDEMLADKAALVVEVVGDNYHHAPIVGIALANERGRFFLRPETALADPKFLAWLGDETKKKTMFDSKRAAVALKWKGIELRGVVFDLLLAAYLLDPAQAAGDVAAVAKMHQYEAVRSDEAVYGKGAKRTVPDEPTLAEHLVRKAAAIWALEEPLMDELRRNEQDRLLTELEQPLAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTGYSTSADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPIQGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEEIERLCRLVPEVMEQAVTLRVPLKVDYHYGPTWYDAK 876
               SCOP domains d3ez5d1 D:298-468 Exonuclease domain of prokaryotic DNA polymerase                                                                                                         d3ez5d2 D:469-876 DNA polymerase I (Klenow fragment)                                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 3ez5D01 D:298-490  [code=3.30.420.10, no name defined]                                                                                                                                           3ez5D02 D:491-605 Taq DNA Polymerase; Chain T, domain 4                                                            3ez5D03 D:606-656,D:801-875                        3ez5D04 D:657-800 5' to 3' exonuclease, C-terminal subdomain                                                                                    3ez5D03 D:606-656,D:801-875  [code=3.30.70.370, no name defined]           - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee....hhhhhh.eeeeeee............eeeeee..eeeeehhhhhh.hhhhhhhhh....eeee.hhhhhhhhhhh.......eeeehhhhhhhhhhhhh..hhhhhhhh.......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh........ee..ee..hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee..eee.........eee..........hhhhhhhhh.ee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheee.....eee.hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee...eeeeeee..hhhhhhhhhhhhhhh.........eeeeee....... Sec.struct. author
                 SAPs(SNPs) K-A-----R--E----------L--------D-----------H--------------Q-V----------S------------------C--S-------------------R-A---K------P-----------A-----V-------------E--R---------------V-----------E---A-------------K--R-K-----Q-----------------------E--------------------------Y-----N----------------------R-D-K----I-------------T-------------------------S--------------------------M-----D------------Q-------P----------------------------S------------E------R--E--------------------------------------M-------------------------K------------------------M----------------------------S------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DNA_POLYMERASE_A    ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ez5 D 298 KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK 876
                                   307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867

Chain E from PDB  Type:DNA  Length:9
                                         
                 3ez5 E  21 CCTGACTCG  29

Chain F from PDB  Type:DNA  Length:12
                                            
                 3ez5 F   1 ATTCGAGTCAGG  12
                                    10

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (4, 8)

Pfam Domains (0, 0)

Gene Ontology (17, 17)

Asymmetric Unit(hide GO term definitions)

Chain A,D (DPO1_GEOSE | P52026)

molecular function
	GO:0008408	3'-5' exonuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' end.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003887	DNA-directed DNA polymerase activity	Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004527	exonuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' or 5' end.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004518	nuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0071897	DNA biosynthetic process	The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006261	DNA-dependent DNA replication	A DNA replication process that uses parental DNA as a template for the DNA-dependent DNA polymerases that synthesize the new strands.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0090305	nucleic acid phosphodiester bond hydrolysis	The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 12)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (48, 96)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (4, 8)

Pfam Domains (0, 0)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File