2POP - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF TAB1 AND BIR1 COMPLEX

Authors :   S. C. Lin

Date :   27 Apr 07 (Deposition) - 03 Jul 07 (Release) - 14 Jun 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.10

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Zinc Finger, Pp2C-Like Domain, Bir Domain, Signaling Protein- Apoptosis Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Lu, S. C. Lin, Y. Huang, Y. J. Kang, R. Rich, Y. C. Lo, D. Myszka, J. Han, H. Wu
Xiap Induces Nf-Kappab Activation Via The Bir1/Tab1 Interaction And Bir1 Dimerization.
Mol. Cell V. 26 689 2007
PubMed-ID: 17560374 | Reference-DOI: 10.1016/J.MOLCEL.2007.05.006

Molecule 1 - MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 7- INTERACTING PROTEIN 1
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI K12
	Expression System Plasmid	:	PET-28
	Expression System Strain	:	K-12
	Expression System Taxid	:	83333
	Expression System Vector Type	:	PLASMID
	Fragment	:	N-TERMINAL PP2C-LIKE DOMAIN, RESIDUES 1-370
	Gene	:	TAB1, MAP3K7IP1
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TGF-BETA-ACTIVATED KINASE 1 AND MAP3K7-BINDING PROTEIN 1, TGF-BETA-ACTIVATED KINASE 1-BINDING PROTEIN 1,TAK1-BINDING PROTEIN 1

Molecule 2 - BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 4
	Chains	:	B, D
	EC Number	:	2.3.2.27
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI K12
	Expression System Plasmid	:	PGEX-4T3
	Expression System Strain	:	K-12
	Expression System Taxid	:	83333
	Expression System Vector Type	:	PLASMID
	Fragment	:	BIR1 DOMAIN RESIDUES 10-100
	Gene	:	XIAP, API3, BIRC4, IAP3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	E3 UBIQUITIN-PROTEIN LIGASE XIAP,IAP-LIKE PROTEIN,HILP, INHIBITOR OF APOPTOSIS PROTEIN 3,HIAP3,RING-TYPE E3 UBIQUITIN TRANSFERASE XIAP,X-LINKED INHIBITOR OF APOPTOSIS PROTEIN,X-LINKED IAP

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	ZN	2	Ligand/Ion	ZINC ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS B:1063 , CYS B:1066 , HIS B:1083 , CYS B:1090	BINDING SITE FOR RESIDUE ZN B 1500
2	AC2	SOFTWARE	CYS D:3063 , CYS D:3066 , HIS D:3083 , CYS D:3090	BINDING SITE FOR RESIDUE ZN D 3500

Asymmetric/Biological Unit

No.	Residues
1	B:1063	-	B:1090
2	B:1066	-	B:1090
3	D:3063	-	D:3090

(no "Cis Peptide Bond" information available for 2POP)

Asymmetric/Biological Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_039271	D	224	E	TAB1_HUMAN	Polymorphism	17001096	A C	D	224 2224	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BIR_REPEAT_1	PS01282	BIR repeat.	XIAP_HUMAN	26-93 163-230 265-330	2	B:1026-1093 D:3026-3093 - -
2	PPM_2	PS51746	PPM-type phosphatase domain profile.	TAB1_HUMAN	28-365	2	A:28-365 C:2028-2365
3	BIR_REPEAT_2	PS50143	BIR repeat profile.	XIAP_HUMAN	29-94 166-231 268-331	2	B:1029-1094 D:3029-3094 - -

Asymmetric/Biological Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000216160	1a	ENSE00001313059	chr22:39795746-39795840	95	TAB1_HUMAN	1-11	11	0	-	-
1.3d	ENST00000216160	3d	ENSE00000880355	chr22:39811011-39811147	137	TAB1_HUMAN	12-57	46	2	A:18-57 C:2018-2057	40 40
1.4a	ENST00000216160	4a	ENSE00000654725	chr22:39811505-39811658	154	TAB1_HUMAN	57-108	52	2	A:57-108 C:2057-2108	52 52
1.5e	ENST00000216160	5e	ENSE00000654726	chr22:39812796-39812882	87	TAB1_HUMAN	109-137	29	2	A:109-132 (gaps) C:2109-2123	24 15
1.6b	ENST00000216160	6b	ENSE00000654728	chr22:39813716-39813854	139	TAB1_HUMAN	138-184	47	2	A:152-184 C:2152-2184	33 33
1.7b	ENST00000216160	7b	ENSE00000654729	chr22:39814737-39814850	114	TAB1_HUMAN	184-222	39	2	A:184-222 C:2184-2222	39 39
1.8	ENST00000216160	8	ENSE00000654730	chr22:39815524-39815635	112	TAB1_HUMAN	222-259	38	2	A:222-259 C:2222-2259	38 38
1.9c	ENST00000216160	9c	ENSE00000654731	chr22:39817832-39817976	145	TAB1_HUMAN	259-307	49	2	A:259-307 C:2259-2307	49 49
1.10	ENST00000216160	10	ENSE00000654732	chr22:39822708-39822930	223	TAB1_HUMAN	308-382	75	2	A:308-370 C:2308-2370	63 63
1.11b	ENST00000216160	11b	ENSE00000654734	chr22:39824026-39824188	163	TAB1_HUMAN	382-436	55	0	-	-
1.12	ENST00000216160	12	ENSE00001109364	chr22:39826020-39827887	1868	TAB1_HUMAN	436-504	69	0	-	-

2.2a	ENST00000371199	2a	ENSE00001810722	X:122993877-122994143	267	XIAP_HUMAN	-	0	0	-	-
2.3c	ENST00000371199	3c	ENSE00002176074	X:123019481-123020389	909	XIAP_HUMAN	1-293	293	2	B:1022-1100 D:3019-3098	79 80
2.4b	ENST00000371199	4b	ENSE00001649641	X:123022469-123022568	100	XIAP_HUMAN	293-326	34	0	-	-
2.5b	ENST00000371199	5b	ENSE00001630752	X:123025088-123025166	79	XIAP_HUMAN	326-352	27	0	-	-
2.6	ENST00000371199	6	ENSE00001714518	X:123026581-123026623	43	XIAP_HUMAN	353-367	15	0	-	-
2.7b	ENST00000371199	7b	ENSE00001653318	X:123034343-123034543	201	XIAP_HUMAN	367-434	68	0	-	-
2.8e	ENST00000371199	8e	ENSE00001454620	X:123040838-123047829	6992	XIAP_HUMAN	434-497	64	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:326
 aligned with TAB1_HUMAN | Q15750 from UniProtKB/Swiss-Prot  Length:504

    Alignment length:353
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367   
          TAB1_HUMAN     18 TDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLG  370
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2popA00 A:18-370 Phosphatase 2c; Domain 1                                                                                                                                                                                                                                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee..eeee..eeee......eeeeeeee...eeeeeeeeee....hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh..--------.-------------------.hhhhhhhhhh..eeeeeeeee...eeeeeee...eeeeeeee..eeeeee........hhhhhhhhhhh..hhhhhhhhh..........eehhhhhhhhhhh...............eeeeeee.....eeeeeehhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.ee..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------PPM_2  PDB: A:28-365 UniProt: 28-365                                                                                                                                                                                                                                                                                                              ----- PROSITE (2)
           Transcript 1 (1) Exon 1.3d  PDB: A:18-57 UniProt: 12-57  ---------------------------------------------------Exon 1.5e UniProt: 109-137   Exon 1.6b  PDB: A:152-184 UniProt: 138-184     -------------------------------------Exon 1.8  PDB: A:222-259              ------------------------------------------------Exon 1.10  PDB: A:308-370 UniProt: 308-382 [INCOMPLETE]         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.4a  PDB: A:57-108 UniProt: 57-108            ---------------------------------------------------------------------------Exon 1.7b  PDB: A:184-222              ------------------------------------Exon 1.9c  PDB: A:259-307 UniProt: 259-307       --------------------------------------------------------------- Transcript 1 (2)
                2pop A   18 TDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDD--------Q-------------------LERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLG  370
                                    27        37        47        57        67        77        87        97       107       117     |   -    |    -         -    |  157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367   
                                                                                                                                   123      132                 152

Chain B from PDB  Type:PROTEIN  Length:79
 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot  Length:497

    Alignment length:79
                                    31        41        51        61        71        81        91         
          XIAP_HUMAN     22 EFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLEN  100
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains 2popB00 B:1022-1100 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A      CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..........hhhhhhhh.eee......eee.....ee.......hhhhhhhhhh..hhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----BIR_REPEAT_1  PDB: B:1026-1093 UniProt: 26-93                       ------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------BIR_REPEAT_2  PDB: B:1029-1094 UniProt: 29-94                     ------ PROSITE (3)
               Transcript 2 Exon 2.3c  PDB: B:1022-1100 UniProt: 1-293 [INCOMPLETE]                         Transcript 2
                2pop B 1022 EFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLEN 1100
                                  1031      1041      1051      1061      1071      1081      1091

Chain C from PDB  Type:PROTEIN  Length:325
 aligned with TAB1_HUMAN | Q15750 from UniProtKB/Swiss-Prot  Length:504

    Alignment length:353
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367   
          TAB1_HUMAN     18 TDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLG  370
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2popC00 C:2018-2370 Phosphatase 2c; Domain 1                                                                                                                                                                                                                                                                                                                      CATH domains
           Pfam domains (1) ---------------------------------------------------PP2C-2popC01 C:2069-2334                                                                                                                                                                                                                                                  ------------------------------------ Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------PP2C-2popC02 C:2069-2334                                                                                                                                                                                                                                                  ------------------------------------ Pfam domains (2)
         Sec.struct. author .........eeeeee..ee..............eeeeeeee...eeeeeeeeee....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh..----------------------------.hhhhhhhhhh..eeeeeeeee...eeeeeee...eeeeeeee..eeeeee........hhhhhhhhhhh..hhhhhhhhh..........eehhhhhhhhhhh...............eeeeeee.....eeeeeehhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.ee..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------PPM_2  PDB: C:2028-2365 UniProt: 28-365                                                                                                                                                                                                                                                                                                           ----- PROSITE (2)
           Transcript 1 (1) Exon 1.3d  PDB: C:2018-2057 [INCOMPLETE]---------------------------------------------------Exon 1.5e  PDB: C:2109-2123  Exon 1.6b  PDB: C:2152-2184 UniProt: 138-184   -------------------------------------Exon 1.8  PDB: C:2222-2259            ------------------------------------------------Exon 1.10  PDB: C:2308-2370 UniProt: 308-382 [INCOMPLETE]       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.4a  PDB: C:2057-2108 UniProt: 57-108         ---------------------------------------------------------------------------Exon 1.7b  PDB: C:2184-2222            ------------------------------------Exon 1.9c  PDB: C:2259-2307 UniProt: 259-307     --------------------------------------------------------------- Transcript 1 (2)
                2pop C 2018 TDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDD----------------------------LERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLG 2370
                                  2027      2037      2047      2057      2067      2077      2087      2097      2107      2117     |   -         -         -    | 2157      2167      2177      2187      2197      2207      2217      2227      2237      2247      2257      2267      2277      2287      2297      2307      2317      2327      2337      2347      2357      2367   
                                                                                                                                  2123                         2152

Chain D from PDB  Type:PROTEIN  Length:80
 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot  Length:497

    Alignment length:80
                                    28        38        48        58        68        78        88        98
          XIAP_HUMAN     19 KEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYL   98
               SCOP domains -------------------------------------------------------------------------------- SCOP domains
               CATH domains 2popD00 D:3019-3098 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A       CATH domains
           Pfam domains (1) ----------BIR-2popD01 D:3029-3094                                           ---- Pfam domains (1)
           Pfam domains (2) ----------BIR-2popD02 D:3029-3094                                           ---- Pfam domains (2)
         Sec.struct. author ......hhhhhhhh..........hhhhhhhh.eee......eee.....ee.......hhhhhhhhhh..hhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------BIR_REPEAT_1  PDB: D:3026-3093 UniProt: 26-93                       ----- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------BIR_REPEAT_2  PDB: D:3029-3094 UniProt: 29-94                     ---- PROSITE (3)
               Transcript 2 Exon 2.3c  PDB: D:3019-3098 UniProt: 1-293 [INCOMPLETE]                          Transcript 2
                2pop D 3019 KEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYL 3098
                                  3028      3038      3048      3058      3068      3078      3088      3098

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2POP)

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 4-Layer Sandwich (459)

Topology: Phosphatase 2c; domain 1 (23)

Homologous Superfamily: Phosphatase 2c; Domain 1 (23)

Human (Homo sapiens) (11)

1a	2popC00	C:2018-2370
1b	2popA00	A:18-370

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A (42)

Homologous Superfamily: Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A (42)

Human (Homo sapiens) (35)

2a	2popD00	D:3019-3098
2b	2popB00	B:1022-1100

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: BIR-like (25)

Family: BIR (25)

Homo sapiens (Human) (24)

1a	BIR-2popD01	D:3029-3094
1b	BIR-2popD02	D:3029-3094

Clan: PP2C (22)

Family: PP2C (13)

Homo sapiens (Human) (3)

2a	PP2C-2popC01	C:2069-2334
2b	PP2C-2popC02	C:2069-2334

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C (TAB1_HUMAN | Q15750)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0008047	enzyme activator activity	Binds to and increases the activity of an enzyme.
	GO:0019209	kinase activator activity	Binds to and increases the activity of a kinase, an enzyme which catalyzes of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
biological process
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0007249	I-kappaB kinase/NF-kappaB signaling	The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
	GO:0007254	JNK cascade	An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0002755	MyD88-dependent toll-like receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
	GO:0000187	activation of MAPK activity	The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
	GO:0000185	activation of MAPKKK activity	Any process that initiates the activity of the inactive enzyme MAP kinase kinase kinase (MAPKKK).
	GO:0035904	aorta development	The progression of the aorta over time, from its initial formation to the mature structure. An aorta is an artery that carries blood from the heart to other parts of the body.
	GO:0003279	cardiac septum development	The progression of a cardiac septum over time, from its initial formation to the mature structure.
	GO:0060976	coronary vasculature development	The process whose specific outcome is the progression of the blood vessels of the heart over time, from its formation to the mature structure.
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0001701	in utero embryonic development	The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Chain B,D (XIAP_HUMAN | P98170)

molecular function
	GO:0004869	cysteine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of a cysteine-type endopeptidase, any enzyme that hydrolyzes peptide bonds in polypeptides by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	Stops, prevents or reduces the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0061630	ubiquitin protein ligase activity	Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0055070	copper ion homeostasis	Any process involved in the maintenance of an internal steady state of copper ions within an organism or cell.
	GO:1990001	inhibition of cysteine-type endopeptidase activity involved in apoptotic process	Any process that prevents the activation of an inactive cysteine-type endopeptidase involved in an apoptotic process.
	GO:0090307	mitotic spindle assembly	The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0090263	positive regulation of canonical Wnt signaling pathway	Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:1902530	positive regulation of protein linear polyubiquitination	Any process that activates or increases the frequency, rate or extent of protein linear polyubiquitination.
	GO:0031398	positive regulation of protein ubiquitination	Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0030510	regulation of BMP signaling pathway	Any process that modulates the frequency, rate or extent of the activity of any BMP receptor signaling pathway.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0050727	regulation of inflammatory response	Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
	GO:0045088	regulation of innate immune response	Any process that modulates the frequency, rate or extent of the innate immune response, the organism's first line of defense against infection.
	GO:0070424	regulation of nucleotide-binding oligomerization domain containing signaling pathway	Any process that modulates the frequency, rate, or extent of a nucleotide-binding oligomerization domain containing (NOD) pathway.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005876	spindle microtubule	Any microtubule that is part of a mitotic or meiotic spindle; anchored at one spindle pole.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pop)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2pop
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TAB1_HUMAN \| Q15750
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	XIAP_HUMAN \| P98170
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.2.27
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TAB1_HUMAN \| Q15750
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	XIAP_HUMAN \| P98170
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

2poi	BIR1 ALONE
2pom	TAB1 ALONE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (3, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (54, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File