|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 10)
|
Asymmetric Unit (10, 10)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 3CLX) |
(no "SAP(SNP)/Variant" information available for 3CLX) |
Asymmetric Unit (2, 8)
|
Asymmetric Unit (4, 16)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:99 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:99 265 275 285 295 305 315 325 335 345 XIAP_HUMAN 256 LPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 SCOP domains d3clxa_ A: BIR domains of XIAP SCOP domains CATH domains 3clxA00 A:256-354 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------BIR_REPEAT_1 PDB: A:265-330 UniProt: 265-330 ------------------------ PROSITE (1) PROSITE (2) ------------BIR_REPEAT_2 PDB: A:268-331 UniProt: 268-331 ----------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: A:256-293 [INCOMPLETE]--------------------------------Exon 1.5b PDB: A:326-352 1. Transcript 1 (1) Transcript 1 (2) -------------------------------------Exon 1.4b PDB: A:293-326 ---------------------------- Transcript 1 (2) 3clx A 256 LPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 265 275 285 295 305 315 325 335 345 Chain B from PDB Type:PROTEIN Length:101 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:101 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 SCOP domains d3clxb_ B: BIR domains of XIAP SCOP domains CATH domains 3clxB00 B:254-354 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: B:265-330 UniProt: 265-330 ------------------------ PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: B:268-331 UniProt: 268-331 ----------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: B:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: B:326-352 1. Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: B:293-326 ---------------------------- Transcript 1 (2) 3clx B 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 263 273 283 293 303 313 323 333 343 353 Chain C from PDB Type:PROTEIN Length:98 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:98 265 275 285 295 305 315 325 335 345 XIAP_HUMAN 256 LPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLV 353 SCOP domains d3clxc_ C: BIR domains of XIAP SCOP domains CATH domains 3clxC00 C:256-353 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------BIR_REPEAT_1 PDB: C:265-330 UniProt: 265-330 ----------------------- PROSITE (1) PROSITE (2) ------------BIR_REPEAT_2 PDB: C:268-331 UniProt: 268-331 ---------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: C:256-293 [INCOMPLETE]--------------------------------Exon 1.5b PDB: C:326-352 1 Transcript 1 (1) Transcript 1 (2) -------------------------------------Exon 1.4b PDB: C:293-326 --------------------------- Transcript 1 (2) 3clx C 256 LPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLV 353 265 275 285 295 305 315 325 335 345 Chain D from PDB Type:PROTEIN Length:101 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:101 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 SCOP domains d3clxd_ D: BIR domains of XIAP SCOP domains CATH domains 3clxD00 D:254-354 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: D:265-330 UniProt: 265-330 ------------------------ PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: D:268-331 UniProt: 268-331 ----------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: D:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: D:326-352 1. Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: D:293-326 ---------------------------- Transcript 1 (2) 3clx D 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 263 273 283 293 303 313 323 333 343 353
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3CLX) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (XIAP_HUMAN | P98170)
|
|
|
|
|
|
|