|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 8)| Asymmetric/Biological Unit (4, 8) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (4, 4)
Asymmetric/Biological Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3GXY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3GXY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3GXY) |
Exons (0, 0)| (no "Exon" information available for 3GXY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:101 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 10 20 30 40 50 60 70 80 90 100 CVN_NOSEL 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 SCOP domains d3gxya_ A: Cyanovirin-N SCOP domains CATH domains 3gxyA00 A:1-101 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 3gxy A 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:101 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 10 20 30 40 50 60 70 80 90 100 CVN_NOSEL 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 SCOP domains d3gxyb_ B: Cyanovirin-N SCOP domains CATH domains 3gxyB00 B:1-101 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 3gxy B 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3GXY) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CVN_NOSEL | P81180)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|